MS4A4E (membrane spanning 4-domains A4E)

Gene
Gene Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
643680
Gene name Gene Name - the full gene name approved by the HGNC.
Membrane spanning 4-domains A4E
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MS4A4E
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q12.2
Summary Summary of gene provided in NCBI Entrez Gene.
Most MS4A genes, including MS4A4E, encode proteins with at least 4 potential transmembrane domains and N- and C-terminal cytoplasmic domains encoded by distinct exons.[supplied by OMIM, Apr 2004]
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein
Show/Hide all(1)
GO ID Ontology Definition Evidence Reference
GO:0016020 Component Membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
608401 14284 ENSG00000214787
Protein
Gene Gene ontology Other IDs Protein
UniProt ID Q96PG1
Protein name Putative membrane-spanning 4-domains subfamily A member 4E
Family and domains
Sequence 
MTTMQGMEQTTPGAGPDVPQLGNIDVIHSYLCKGLQEKFFKRKPKVLGVVRILIALMSLS
MGIIMMCVAFSSYEEHPIFVYVAYTIWGSVMYPYQLQQELEQQKVWNYLKNLSWRIMGSY
LCFGERSELKPL
Sequence length 132
Interactions View interactions
<