Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6434
Gene name Gene Name - the full gene name approved by the HGNC.
Transformer 2 beta homolog
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TRA2B
Synonyms (NCBI Gene) Gene synonyms aliases
Htra2-beta, PPP1R156, SFRS10, SRFS10, TRA2-BETA, TRAN2B
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q27.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a nuclear protein which functions as sequence-specific serine/arginine splicing factor which plays a role in mRNA processing, splicing patterns, and gene expression. Alternative splicing results in multiple transcript variants. [provided
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT006537 hsa-miR-10a-5p Luciferase reporter assay 21118818
MIRT006538 hsa-miR-10b-5p Luciferase reporter assay 21118818
MIRT006537 hsa-miR-10a-5p Luciferase reporter assay 21118818
MIRT006538 hsa-miR-10b-5p Luciferase reporter assay 21118818
MIRT024099 hsa-miR-1-3p Proteomics 18668040
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000375 Process RNA splicing, via transesterification reactions TAS 9546399
GO:0000381 Process Regulation of alternative mRNA splicing, via spliceosome IDA 12165565, 12761049
GO:0000381 Process Regulation of alternative mRNA splicing, via spliceosome IMP 25689357
GO:0000398 Process MRNA splicing, via spliceosome IDA 9546399
GO:0000398 Process MRNA splicing, via spliceosome IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602719 10781 ENSG00000136527
Protein
UniProt ID P62995
Protein name Transformer-2 protein homolog beta (TRA-2 beta) (TRA2-beta) (hTRA2-beta) (Splicing factor, arginine/serine-rich 10) (Transformer-2 protein homolog B)
Protein function Sequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing. Can either activate or suppress exon inclusion. Acts additively with RBMX to promote exon 7 inclusion of the survival motor neuron SMN2. Activates the
PDB 2CQC , 2KXN , 2RRA , 2RRB
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 120 190 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Highest expression in heart, skeletal muscle and pancreas. Less abundant in kidney, placenta and brain. Lowest expression in kidney and liver. {ECO:0000269|PubMed:9790768}.
Sequence
MSDSGEQNYGERESRSASRSGSAHGSGKSARHTPARSRSKEDSRRSRSKSRSRSESRSRS
RRSSRRHYTRSRSRSRSHRRSRSRSYSRDYRRRHSHSHSPMSTRRRHVGNRANPDPNCCL
GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERAN
GMELDGRRIR
VDFSITKRPHTPTPGIYMGRPTYGSSRRRDYYDRGYDRGYDDRDYYSRSY
RGGGGGGGGWRAAQDRDQIYRRRSPSPYYSRGGYRSRSRSRSYSPRRY
Sequence length 288
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Spliceosome
Alcoholic liver disease
  mRNA Splicing - Major Pathway
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Dental caries Dental caries N/A N/A GWAS
Diabetes Type 2 diabetes N/A N/A GWAS
Glioblastoma Glioblastoma N/A N/A GWAS
Neurodevelopmental Disorders complex neurodevelopmental disorder, neurodevelopmental disorder N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 23874428, 25342468
Alcohol Related Disorders Associate 37958557
Alcoholism Associate 34857913
Alzheimer Disease Associate 16371011, 34857913
Autism Spectrum Disorder Associate 36549593
Brain Diseases Associate 36549593
Breast Neoplasms Associate 31775037, 33176162, 34895237
Colorectal Neoplasms Associate 24865968, 25342468, 31311954
Developmental Disabilities Associate 36549593
Diabetes Mellitus Type 2 Associate 27515906