Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
64332
Gene name Gene Name - the full gene name approved by the HGNC.
NFKB inhibitor zeta
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NFKBIZ
Synonyms (NCBI Gene) Gene synonyms aliases
I-kappa-B-zeta, IKBZ, INAP, IkappaB-zeta, MAIL, ikB-zeta, ikappaBzeta
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q12.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the ankyrin-repeat family and is induced by lipopolysaccharide (LPS). The C-terminal portion of the encoded product which contains the ankyrin repeats, shares high sequence similarity with the I kappa B family of proteins. The lat
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT005083 hsa-miR-124-3p Luciferase reporter assay, qRT-PCR, Western blot 19502795
MIRT005083 hsa-miR-124-3p Luciferase reporter assay, qRT-PCR, Western blot 19502795
MIRT005083 hsa-miR-124-3p Luciferase reporter assay, qRT-PCR, Western blot 19502795
MIRT019222 hsa-miR-335-5p Microarray 18185580
MIRT024334 hsa-miR-215-5p Microarray 19074876
Transcription factors
Transcription factor Regulation Reference
NFKB1 Unknown 20220144
RELA Unknown 20220144
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0002224 Process Toll-like receptor signaling pathway IEA
GO:0002250 Process Adaptive immune response IEA
GO:0002285 Process Lymphocyte activation involved in immune response IEA
GO:0002317 Process Plasma cell differentiation IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608004 29805 ENSG00000144802
Protein
UniProt ID Q9BYH8
Protein name NF-kappa-B inhibitor zeta (I-kappa-B-zeta) (IkB-zeta) (IkappaBzeta) (IL-1 inducible nuclear ankyrin-repeat protein) (INAP) (Molecule possessing ankyrin repeats induced by lipopolysaccharide) (MAIL)
Protein function Involved in regulation of NF-kappa-B transcription factor complexes (PubMed:16513645, PubMed:16622025). Inhibits NF-kappa-B activity without affecting its nuclear translocation upon stimulation (PubMed:16513645). Inhibits DNA-binding of RELA and
PDB 9BOR
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12796 Ank_2 581 683 Ankyrin repeats (3 copies) Repeat
Tissue specificity TISSUE SPECIFICITY: Expressed at high levels in peripheral blood leukocytes and lung, at moderate levels in liver, placenta, and at low levels in spleen, kidney, skeletal muscle and heart. {ECO:0000269|PubMed:16513645}.
Sequence
MIVDKLLDDSRGGEGLRDAAGGCGLMTSPLNLSYFYGASPPAAAPGACDASCSVLGPSAP
GSPGSDSSDFSSASSVSSCGAVESRSRGGARAERQPVEPHMGVGRQQRGPFQGVRVKNSV
KELLLHIRSHKQKASGQAVDDFKTQGVNIEQFRELKNTVSYSGKRKGPDSLSDGPACKRP
ALLHSQFLTPPQTPTPGESMEDVHLNEPKQESSADLLQNIINIKNECSPVSLNTVQVSWL
NPVVVPQSSPAEQCQDFHGGQVFSPPQKCQPFQVRGSQQMIDQASLYQYSPQNQHVEQQP
HYTHKPTLEYSPFPIPPQSPAYEPNLFDGPESQFCPNQSLVSLLGDQRESENIANPMQTS
SSVQQQNDAHLHSFSMMPSSACEAMVGHEMASDSSNTSLPFSNMGNPMNTTQLGKSLFQW
QVEQEESKLANISQDQFLSKDADGDTFLHIAVAQGRRALSYVLARKMNALHMLDIKEHNG
QSAFQVAVAANQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSN
QFVDLEATNYDGLTPLHCAVIAHNAVVHELQRNQQPHSPEVQELLLKNKSLVDTIKCLIQ
MGAAVEAKDRKSGRTALHLAAEEANLELIRLFLELPSCLSFVNAKAYNGNTALHVAASLQ
YRLTQLDAVRLLMRKGADPSTRN
LENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY
Sequence length 718
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Transcriptional misregulation in cancer  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Colorectal Cancer hereditary nonpolyposis colon cancer, Colorectal cancer N/A N/A GenCC, GWAS
Inflammatory Bowel Disease Inflammatory bowel disease N/A N/A GWAS
Ulcerative colitis Ulcerative colitis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Behcet Syndrome Associate 26890122
Breast Neoplasms Associate 35441810, 38066224
Colorectal Neoplasms Associate 25058500
COVID 19 Associate 35777990, 39384777
Death Associate 35777990
Depressive Disorder Associate 23064081
Inflammation Associate 24341743, 25347003, 27117051, 32079724
Inflammatory Bowel Diseases Associate 36643579
Leukemia Lymphocytic Chronic B Cell Associate 28775123
Lymphoma Associate 26702065