Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6430
Gene name	Serine and arginine rich splicing factor 5
Gene symbol	SRSF5
Synonyms (NCBI Gene)	HRSSFRS5SRP40
Chromosome	14
Chromosome location	14q24.1
Summary	The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for

Show/Hide all (79)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023067	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT024020	hsa-miR-1-3p	Proteomics	18668040
MIRT049180	hsa-miR-92a-3p	CLASH	23622248
MIRT036252	hsa-miR-1236-3p	CLASH	23622248
MIRT1390809	hsa-miR-1197	CLIP-seq
MIRT1390810	hsa-miR-1276	CLIP-seq
MIRT1390811	hsa-miR-1283	CLIP-seq
MIRT1390812	hsa-miR-198	CLIP-seq
MIRT1390813	hsa-miR-3065-5p	CLIP-seq
MIRT1390814	hsa-miR-3127-3p	CLIP-seq
MIRT1390815	hsa-miR-323-5p	CLIP-seq
MIRT1390816	hsa-miR-338-3p	CLIP-seq
MIRT1390817	hsa-miR-4311	CLIP-seq
MIRT1390818	hsa-miR-4530	CLIP-seq
MIRT1390819	hsa-miR-4690-3p	CLIP-seq
MIRT1390820	hsa-miR-4725-5p	CLIP-seq
MIRT1390821	hsa-miR-4780	CLIP-seq
MIRT1390822	hsa-miR-504	CLIP-seq
MIRT1390823	hsa-miR-520d-5p	CLIP-seq
MIRT1390824	hsa-miR-524-5p	CLIP-seq
MIRT1390825	hsa-miR-570	CLIP-seq
MIRT1390826	hsa-miR-583	CLIP-seq
MIRT1390827	hsa-miR-646	CLIP-seq
MIRT1390828	hsa-miR-765	CLIP-seq
MIRT1390829	hsa-miR-876-3p	CLIP-seq
MIRT1390830	hsa-miR-1303	CLIP-seq
MIRT1390831	hsa-miR-1305	CLIP-seq
MIRT1390813	hsa-miR-3065-5p	CLIP-seq
MIRT1390832	hsa-miR-3122	CLIP-seq
MIRT1390814	hsa-miR-3127-3p	CLIP-seq
MIRT1390833	hsa-miR-374c	CLIP-seq
MIRT1390834	hsa-miR-3913-5p	CLIP-seq
MIRT1390835	hsa-miR-3924	CLIP-seq
MIRT1390836	hsa-miR-421	CLIP-seq
MIRT1390837	hsa-miR-451b	CLIP-seq
MIRT1390838	hsa-miR-4666-3p	CLIP-seq
MIRT1390819	hsa-miR-4690-3p	CLIP-seq
MIRT1390820	hsa-miR-4725-5p	CLIP-seq
MIRT1390839	hsa-miR-4766-3p	CLIP-seq
MIRT1390821	hsa-miR-4780	CLIP-seq
MIRT1390822	hsa-miR-504	CLIP-seq
MIRT1390840	hsa-miR-584	CLIP-seq
MIRT1390841	hsa-miR-655	CLIP-seq
MIRT1390809	hsa-miR-1197	CLIP-seq
MIRT1390810	hsa-miR-1276	CLIP-seq
MIRT1390812	hsa-miR-198	CLIP-seq
MIRT2116980	hsa-miR-3143	CLIP-seq
MIRT1390816	hsa-miR-338-3p	CLIP-seq
MIRT1390817	hsa-miR-4311	CLIP-seq
MIRT2116981	hsa-miR-4511	CLIP-seq
MIRT1390818	hsa-miR-4530	CLIP-seq
MIRT1390819	hsa-miR-4690-3p	CLIP-seq
MIRT2116982	hsa-miR-4711-3p	CLIP-seq
MIRT1390820	hsa-miR-4725-5p	CLIP-seq
MIRT1390821	hsa-miR-4780	CLIP-seq
MIRT1390822	hsa-miR-504	CLIP-seq
MIRT2116983	hsa-miR-543	CLIP-seq
MIRT1390826	hsa-miR-583	CLIP-seq
MIRT1390827	hsa-miR-646	CLIP-seq
MIRT1390828	hsa-miR-765	CLIP-seq
MIRT2633171	hsa-miR-124	CLIP-seq
MIRT1390830	hsa-miR-1303	CLIP-seq
MIRT2633172	hsa-miR-3129-3p	CLIP-seq
MIRT2633173	hsa-miR-3714	CLIP-seq
MIRT2633174	hsa-miR-3910	CLIP-seq
MIRT1390835	hsa-miR-3924	CLIP-seq
MIRT2633175	hsa-miR-4427	CLIP-seq
MIRT2633176	hsa-miR-4680-3p	CLIP-seq
MIRT1390820	hsa-miR-4725-5p	CLIP-seq
MIRT1390821	hsa-miR-4780	CLIP-seq
MIRT1390822	hsa-miR-504	CLIP-seq
MIRT2633177	hsa-miR-506	CLIP-seq
MIRT1390825	hsa-miR-570	CLIP-seq
MIRT2633178	hsa-miR-595	CLIP-seq
MIRT1390835	hsa-miR-3924	CLIP-seq
MIRT1390820	hsa-miR-4725-5p	CLIP-seq
MIRT1390821	hsa-miR-4780	CLIP-seq
MIRT1390822	hsa-miR-504	CLIP-seq
MIRT1390825	hsa-miR-570	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000375	Process	RNA splicing, via transesterification reactions	IEA
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	IBA
GO:0001889	Process	Liver development	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	IBA
GO:0005515	Function	Protein binding	IPI	12762840, 23602568, 32296183, 32707033, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006376	Process	MRNA splice site recognition	TAS	7556075
GO:0006397	Process	MRNA processing	IEA
GO:0006397	Process	MRNA processing	TAS	7556075
GO:0008380	Process	RNA splicing	IEA
GO:0016607	Component	Nuclear speck	IBA
GO:0016607	Component	Nuclear speck	ISS
GO:0032868	Process	Response to insulin	IEA
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0033120	Process	Positive regulation of RNA splicing	IEA
GO:0043422	Function	Protein kinase B binding	IEA
GO:0097421	Process	Liver regeneration	IEA

MIM	HGNC	e!Ensembl
600914	10787	ENSG00000100650

Q13243

Protein name

Serine/arginine-rich splicing factor 5 (Delayed-early protein HRS) (Pre-mRNA-splicing factor SRP40) (Splicing factor, arginine/serine-rich 5)

Protein function

Plays a role in constitutive splicing and can modulate the selection of alternative splice sites.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00076	RRM_1	6 → 68	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00076	RRM_1	110 → 175	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

Sequence

MSGCRVFIGRLNPAAREKDVERFFKGYGRIRDIDLKRGFGFVEFEDPRDADDAVYELDGK
ELCSERVTIEHARARSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTENRLIVENLSSRVS
WQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASYGDLKNAIEKLSGKEINGRKIKLIEGS
KRHSRSRSRSRSRTRSSSRSRSRSRSRSRKSYSRSRSRSRSRSRSKSRSVSRSPVPEKSQ
KRGSSSRSKSPASVDRQRSRSRSRSRSVDSGN

Sequence length

272

Interactions

View interactions

	KEGG		Reactome
	Spliceosome Herpes simplex virus 1 infection		Transport of Mature mRNA derived from an Intron-Containing Transcript mRNA Splicing - Major Pathway mRNA 3'-end processing RNA Polymerase II Transcription Termination

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	31731374, 33142748	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Associate	24393808	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Associate	37515398	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	23284704, 34291726	★★★★★ ★☆☆☆☆ Found in Text Mining only

SRSF5 (serine and arginine rich splicing factor 5)