ZSCAN31 (zinc finger and SCAN domain containing 31)

Gene
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
64288
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger and SCAN domain containing 31
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZSCAN31
Synonyms (NCBI Gene) Gene synonyms aliases
ZNF20-Lp, ZNF310P, ZNF323
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p22.1|6p22.3-p22.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein containing multiple C2H2-type zinc finger motifs. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all(6)
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0005634 Component Nucleus IEA
GO:0006357 Process Regulation of transcription by RNA polymerase II IBA 21873635
GO:0046872 Function Metal ion binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
610794 14097 ENSG00000235109
Protein
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID Q96LW9
Protein name Zinc finger and SCAN domain-containing protein 31 (Zinc finger protein 323)
Protein function May function as a transcription factor. May be involved in the development of multiple embryonic organs.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02023 SCAN 35 → 124 SCAN domain Domain
PF00096 zf-C2H2 239 → 261 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 267 → 289 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 295 → 317 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 351 → 373 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 379 → 401 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed at high levels in the lung, liver, and kidney, while weakly expressed in intestine, brain, muscle, cholecyst, heart, and pancreas. {ECO:0000269|PubMed:12147252}.
Sequence 
MASTEEQYDLKIVKVEEDPIWDQETHLRGNNFSGQEASRQLFRQFCYQETPGPREALSRL
RELCHQWLRPEIHTKEQILELLVLEQFLTILPEELQAWVREHHPESGEEAVAVVEDLEQE
LSEPGNQAPDHEHGHSEVLLEDVEHLKVKQEPTDIQLQPMVTQLRYESFCLHQFQEQDGE
SIPENQELASKQEILKEMEHLGDSKLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHR
CNECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRSSLNEHRRSHTGEKPYQCKEC
GKAFSASNGLTRHRRIHTGEKPYECKVCGKAFLLSSCLVQHQRIHTGEKRYQCRECGKAF
IQNAGLFQHLRVHTGEKPYQCSQCSKLFSKRTLLKKHQKIHTGERP
Sequence length 406
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Lung carcinoma Carcinoma of lung rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355
View all (44 more)		 28604730
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)		 24888570, 26198764
Show/Hide Unknown Diseases (8)
Unknown
Disease term Disease name Evidence References Source
Coronary heart disease Coronary heart disease 21971053 ClinVar
Mental depression Unipolar Depression, Major Depressive Disorder 27089181 ClinVar
Cervical Cancer Cervical Cancer Our screens identified 10 miRNAs that enhance fitness of HeLa cells and have been reported to be up-regulated in cervical cancer (Table2). GWAS, CBGDA
Gastroesophageal Reflux Disease Gastroesophageal Reflux Disease GWAS
Show/Hide Text Mining Associations (3)
Associations from Text Mining
Disease Name Relationship Type References
Lung Injury Associate 33658578
Mental Disorders Associate 34637873
Pulmonary Disease Chronic Obstructive Associate 33658578