Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	64282
Gene name	Terminal nucleotidyltransferase 4B
Gene symbol	TENT4B
Synonyms (NCBI Gene)	PAPD5TRF4-2TUT3
Chromosome	16
Chromosome location	16q12.1

Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	28383716
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IDA	21855801
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IDA	28383716
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0006364	Process	RRNA processing	IEA
GO:0006397	Process	MRNA processing	IEA
GO:0010587	Process	MiRNA catabolic process	IDA	25049417
GO:0016740	Function	Transferase activity	IEA
GO:0016779	Function	Nucleotidyltransferase activity	IEA
GO:0031123	Process	RNA 3'-end processing	IBA
GO:0031124	Process	MRNA 3'-end processing	IDA	28383716
GO:0031499	Component	TRAMP complex	IBA
GO:0031499	Component	TRAMP complex	IDA	21855801
GO:0032211	Process	Negative regulation of telomere maintenance via telomerase	IMP	26950371
GO:0033500	Process	Carbohydrate homeostasis	IMP	28383716
GO:0043634	Process	Polyadenylation-dependent ncRNA catabolic process	IBA
GO:0043634	Process	Polyadenylation-dependent ncRNA catabolic process	IMP	26950371
GO:0046872	Function	Metal ion binding	IEA
GO:0051301	Process	Cell division	IEA
GO:0060212	Process	Negative regulation of nuclear-transcribed mRNA poly(A) tail shortening	IEA
GO:0060212	Process	Negative regulation of nuclear-transcribed mRNA poly(A) tail shortening	IMP	30026317
GO:0070034	Function	Telomerase RNA binding	IPI	26950371
GO:0070568	Function	Guanylyltransferase activity	IEA
GO:0070568	Function	Guanylyltransferase activity	IMP	30026317
GO:0071044	Process	Histone mRNA catabolic process	IMP	18172165
GO:0071051	Process	Poly(A)-dependent snoRNA 3'-end processing	IDA	22442037
GO:1905870	Process	Positive regulation of 3'-UTR-mediated mRNA stabilization	IEA
GO:1905870	Process	Positive regulation of 3'-UTR-mediated mRNA stabilization	IMP	30026317
GO:1990817	Function	Poly(A) RNA polymerase activity	IBA
GO:1990817	Function	Poly(A) RNA polymerase activity	IDA	28383716
GO:1990817	Function	Poly(A) RNA polymerase activity	IEA

MIM	HGNC	e!Ensembl
605540	30758	ENSG00000121274

Q8NDF8

Protein name

Terminal nucleotidyltransferase 4B (Non-canonical poly(A) RNA polymerase PAPD5) (EC 2.7.7.19) (PAP-associated domain-containing protein 5) (Terminal guanylyltransferase) (EC 2.7.7.-) (Terminal uridylyltransferase 3) (TUTase 3) (Topoisomerase-related funct

Protein function

Terminal nucleotidyltransferase that catalyzes preferentially the transfer of ATP and GTP on RNA 3' poly(A) tail creating a heterogeneous 3' poly(A) tail leading to mRNAs stabilization by protecting mRNAs from active deadenylation (PubMed:217883

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01909	NTP_transf_2	145 → 257	Nucleotidyltransferase domain	Family
PF03828	PAP_assoc	308 → 368	Cid1 family poly A polymerase	Family

Sequence

MYRSGERLLGSHALPAEQRDFLPLETTNNNNNHHQPGAWARRAGSSASSPPSASSSPHPS
AAVPAADPADSASGSSNKRKRDNKASGGRAAGGGRADGGGVVYSGTPWKRRNYNQGVVGL
HEEISDFYEYMSPRPEEEKMRMEVVNRIESVIKELWPSADVQIFGSFKTGLYLPTSDIDL
VVFGKWENLPLWTLEEALRKHKVADEDSVKVLDKATVPIIKLTDSFTEVKVDISFNVQNG
VRAADLIKDFTKKYPVLPYLVLVLKQFLLQRDLNEVFTGGIGSYSLFLMAVSFLQLHPRE
DACIPNTNYGVLLIEFFELYGRHFNYLKTGIRIKDGGSYVAKDEVQKNMLDGYRPSMLYI
EDPLQPGNDVGRSSYGAMQVKQAFDYAYVVLSHAVSPIAKYYPNNETESILGRIIRVTDE
VATYRDWISKQWGLKNRPEPSCNGPVSSSSATQSSSSDVDSDATPCKTPKQLLCRPSTGN
RVGSQDVSLESSQAVGKMQSTQTTNTSNSTNKSQHGSARLFRSSSKGFQGTTQTSHGSLM
TNKQHQGKSNNQYYHGKKRKHKRDAPLSDLCR

Sequence length

572

Interactions

View interactions

	KEGG
	RNA degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PREECLAMPSIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TENT4B-related disorder	Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Disease	Associate	25049417	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Associate	30728146, 32559291	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Inhibit	35605178	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Associate	30728146	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Associate	32559291	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	36171087	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	25049417	★★★★★ ★☆☆☆☆ Found in Text Mining only

TENT4B (terminal nucleotidyltransferase 4B)