DNAH10OS (dynein axonemal heavy chain 10 opposite strand)

Gene Gene information from NCBI Gene database.
Gene miRNA Other IDs Protein
Entrez ID 642797
Gene name Dynein axonemal heavy chain 10 opposite strand
Gene symbol DNAH10OS
Synonyms (NCBI Gene)
-
Chromosome 12
Chromosome location 12q24.31
miRNA miRNA information provided by mirtarbase database.
126
Gene miRNA Other IDs Protein
Show/Hide all (126)
miRTarBase ID miRNA Experiments Reference
MIRT624124 hsa-miR-6800-3p HITS-CLIP 23824327
MIRT624123 hsa-miR-1224-3p HITS-CLIP 23824327
MIRT624122 hsa-miR-3183 HITS-CLIP 23824327
MIRT624121 hsa-miR-4723-3p HITS-CLIP 23824327
MIRT624119 hsa-miR-6769b-3p HITS-CLIP 23824327
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Other IDs Protein
MIM HGNC e!Ensembl
HGNC 37121 N/A
Protein Protein information from UniProt database.
Gene miRNA Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0CZ25
Protein name Uncharacterized protein DNAH10OS
Family and domains
Sequence 
MHSLPRSGSIRRTHSDTQATGWPPPQRIGDSPGPSPAFLSCPPSLCGGAAQTGDPVALPH
GPEKWVWGGGLSPRNPHSWGIKAHGLRPPWAPRLERCMVPESEWAPWQPQLPCEPKWLGS
RKSKPHRESGLRGGGPSRCAKRGTHSCGPRESGGPDTCHLPCH
Sequence length 163
Interactions View interactions