Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
642797
Gene name Gene Name - the full gene name approved by the HGNC.
Dynein axonemal heavy chain 10 opposite strand
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DNAH10OS
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q24.31
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT624124 hsa-miR-6800-3p HITS-CLIP 23824327
MIRT624123 hsa-miR-1224-3p HITS-CLIP 23824327
MIRT624122 hsa-miR-3183 HITS-CLIP 23824327
MIRT624121 hsa-miR-4723-3p HITS-CLIP 23824327
MIRT624119 hsa-miR-6769b-3p HITS-CLIP 23824327
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
HGNC 37121 N/A
Protein
UniProt ID P0CZ25
Protein name Uncharacterized protein DNAH10OS
Family and domains
Sequence
MHSLPRSGSIRRTHSDTQATGWPPPQRIGDSPGPSPAFLSCPPSLCGGAAQTGDPVALPH
GPEKWVWGGGLSPRNPHSWGIKAHGLRPPWAPRLERCMVPESEWAPWQPQLPCEPKWLGS
RKSKPHRESGLRGGGPSRCAKRGTHSCGPRESGGPDTCHLPCH
Sequence length 163
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Diabetes Type 2 diabetes (PheCode 250.2) N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS