SFRP5 (secreted frizzled related protein 5)

Gene

• Entrez ID: 6425
• Gene name: Secreted frizzled related protein 5
• Gene symbol: SFRP5
• Synonyms (NCBI Gene): SARP3
• Chromosome: 10
• Chromosome location: 10q24.2
• Summary: Secreted frizzled-related protein 5 (SFRP5) is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. SFRP5 and SFRP1 may be invo

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT731695	hsa-miR-125b-5p	Luciferase reporter assay	27592695
MIRT731695	hsa-miR-125b-5p	Luciferase reporter assay	27592695
MIRT1341980	hsa-miR-3664-5p	CLIP-seq
MIRT1341981	hsa-miR-4714-5p	CLIP-seq
MIRT1341982	hsa-miR-4766-5p	CLIP-seq
MIRT2101216	hsa-miR-1915	CLIP-seq
MIRT2101217	hsa-miR-3925-3p	CLIP-seq
MIRT2101218	hsa-miR-4505	CLIP-seq
MIRT2101219	hsa-miR-4726-3p	CLIP-seq
MIRT2440247	hsa-miR-1225-3p	CLIP-seq
MIRT2440248	hsa-miR-1233	CLIP-seq
MIRT2440249	hsa-miR-204	CLIP-seq
MIRT2440250	hsa-miR-211	CLIP-seq
MIRT2440251	hsa-miR-4446-5p	CLIP-seq
MIRT2440252	hsa-miR-4749-3p	CLIP-seq
MIRT2440253	hsa-miR-4755-5p	CLIP-seq
MIRT2440254	hsa-miR-623	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
DNMT1	Unknown	24374650
DNMT3A	Unknown	24374650

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	TAS	10072424
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IMP	19957335
GO:0006915	Process	Apoptotic process	TAS	9391078
GO:0007163	Process	Establishment or maintenance of cell polarity	TAS	10072424
GO:0007165	Process	Signal transduction	TAS	10072424
GO:0007601	Process	Visual perception	TAS	10072424
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	19957335
GO:0009653	Process	Anatomical structure morphogenesis	TAS	10072424
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0017147	Function	Wnt-protein binding	IBA
GO:0017147	Function	Wnt-protein binding	NAS	24431302
GO:0030154	Process	Cell differentiation	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	NAS	24431302
GO:0035567	Process	Non-canonical Wnt signaling pathway	IBA
GO:0048546	Process	Digestive tract morphogenesis	IEA
GO:0048546	Process	Digestive tract morphogenesis	IMP	18981481
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	19957335
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IMP	18981481, 19957335
GO:2000051	Process	Negative regulation of non-canonical Wnt signaling pathway	IMP	18981481

Other IDs

• MIM: 604158
• HGNC: 10779
• e!Ensembl: ENSG00000120057

Protein

• UniProt ID: Q5T4F7
• Protein name: Secreted frizzled-related protein 5 (sFRP-5) (Frizzled-related protein 1b) (FRP-1b) (Secreted apoptosis-related protein 3) (SARP-3)
• Protein function: Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP5 may be involved in determining t
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01392	Fz	53 → 160	Fz domain	Domain
  PF01759	NTR	195 → 293	UNC-6/NTR/C345C module	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in the retinal pigment epithelium (RPE) and pancreas. Weak expression in heart, liver and muscle. {ECO:0000269|PubMed:10072424, ECO:0000269|PubMed:9391078, ECO:0000269|PubMed:9642118}.
• Sequence:

  MRAAAAGGGVRTAALALLLGALHWAPARCEEYDYYGWQAEPLHGRSYSKPPQCLDIPADL
  PLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRP
  IYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPATAPPVTKI
  CAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKLIGAQKKKKLLKPGPLKRKDT
  KRLVLHMKNGAGCPCPQLDSLAGSFLVMGRKVDGQLLLMAVYRWDKKNKEMKFAVKFMFS
  YPCSLYYPFFYGAAEPH

• Sequence length: 317

Pathways

KEGG:

Wnt signaling pathway