Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6425
Gene name Gene Name - the full gene name approved by the HGNC.	Secreted frizzled related protein 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SFRP5
Synonyms (NCBI Gene) Gene synonyms aliases	SARP3
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q24.2
Summary Summary of gene provided in NCBI Entrez Gene.	Secreted frizzled-related protein 5 (SFRP5) is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. SFRP5 and SFRP1 may be invo

Show/Hide all(17)

miRTarBase ID	miRNA	Experiments	Reference
MIRT731695	hsa-miR-125b-5p	Luciferase reporter assay	27592695
MIRT731695	hsa-miR-125b-5p	Luciferase reporter assay	27592695
MIRT1341980	hsa-miR-3664-5p	CLIP-seq
MIRT1341981	hsa-miR-4714-5p	CLIP-seq
MIRT1341982	hsa-miR-4766-5p	CLIP-seq
MIRT2101216	hsa-miR-1915	CLIP-seq
MIRT2101217	hsa-miR-3925-3p	CLIP-seq
MIRT2101218	hsa-miR-4505	CLIP-seq
MIRT2101219	hsa-miR-4726-3p	CLIP-seq
MIRT2440247	hsa-miR-1225-3p	CLIP-seq
MIRT2440248	hsa-miR-1233	CLIP-seq
MIRT2440249	hsa-miR-204	CLIP-seq
MIRT2440250	hsa-miR-211	CLIP-seq
MIRT2440251	hsa-miR-4446-5p	CLIP-seq
MIRT2440252	hsa-miR-4749-3p	CLIP-seq
MIRT2440253	hsa-miR-4755-5p	CLIP-seq
MIRT2440254	hsa-miR-623	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
DNMT1	Unknown	24374650
DNMT3A	Unknown	24374650

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	TAS	10072424
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IMP	19957335
GO:0006915	Process	Apoptotic process	TAS	9391078
GO:0007163	Process	Establishment or maintenance of cell polarity	TAS	10072424
GO:0007165	Process	Signal transduction	TAS	10072424
GO:0007601	Process	Visual perception	TAS	10072424
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	19957335
GO:0009653	Process	Anatomical structure morphogenesis	TAS	10072424
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0017147	Function	Wnt-protein binding	IBA
GO:0017147	Function	Wnt-protein binding	NAS	24431302
GO:0030154	Process	Cell differentiation	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	NAS	24431302
GO:0035567	Process	Non-canonical Wnt signaling pathway	IBA
GO:0048546	Process	Digestive tract morphogenesis	IEA
GO:0048546	Process	Digestive tract morphogenesis	IMP	18981481
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	19957335
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IMP	18981481, 19957335
GO:2000051	Process	Negative regulation of non-canonical Wnt signaling pathway	IMP	18981481

MIM	HGNC	e!Ensembl
604158	10779	ENSG00000120057

Protein

UniProt ID

Q5T4F7

Protein name

Secreted frizzled-related protein 5 (sFRP-5) (Frizzled-related protein 1b) (FRP-1b) (Secreted apoptosis-related protein 3) (SARP-3)

Protein function

Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP5 may be involved in determining t

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01392	Fz	53 → 160	Fz domain	Domain
PF01759	NTR	195 → 293	UNC-6/NTR/C345C module	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in the retinal pigment epithelium (RPE) and pancreas. Weak expression in heart, liver and muscle. {ECO:0000269|PubMed:10072424, ECO:0000269|PubMed:9391078, ECO:0000269|PubMed:9642118}.

Sequence

MRAAAAGGGVRTAALALLLGALHWAPARCEEYDYYGWQAEPLHGRSYSKPPQCLDIPADL
PLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRP
IYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPATAPPVTKI
CAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKLIGAQKKKKLLKPGPLKRKDT
KRLVLHMKNGAGCPCPQLDSLAGSFLVMGRKVDGQLLLMAVYRWDKKNKEMKFAVKFMFS
YPCSLYYPFFYGAAEPH

Sequence length

317

Interactions

View interactions

	KEGG
	Wnt signaling pathway

SFRP5 (secreted frizzled related protein 5)