Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6424
Gene name	Secreted frizzled related protein 4
Gene symbol	SFRP4
Synonyms (NCBI Gene)	FRP-4FRPHEFRZB-2PYLsFRP-4
Chromosome	7
Chromosome location	7p14.1
Summary	Secreted frizzled-related protein 4 (SFRP4) is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. The expression of SFRP4 in

Show/Hide all (3)

SNP ID	Visualize variation	Clinical significance	Consequence
rs755007671	G>A	Pathogenic	Stop gained, coding sequence variant
rs879253778	CTGTACC>-	Pathogenic	Coding sequence variant, frameshift variant
rs879255603	->C	Pathogenic	Coding sequence variant, frameshift variant

152

Show/Hide all (152)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030345	hsa-miR-26b-5p	Microarray	19088304
MIRT733229	hsa-miR-181a-5p	Immunocytochemistry (ICC)Luciferase reporter assayqRT-PCR	33574092
MIRT1341964	hsa-miR-1256	CLIP-seq
MIRT1341965	hsa-miR-1297	CLIP-seq
MIRT1341966	hsa-miR-183	CLIP-seq
MIRT1341967	hsa-miR-203	CLIP-seq
MIRT1341968	hsa-miR-2052	CLIP-seq
MIRT1341969	hsa-miR-26a	CLIP-seq
MIRT1341970	hsa-miR-26b	CLIP-seq
MIRT1341971	hsa-miR-3676	CLIP-seq
MIRT1341972	hsa-miR-3907	CLIP-seq
MIRT1341973	hsa-miR-4299	CLIP-seq
MIRT1341974	hsa-miR-4456	CLIP-seq
MIRT1341975	hsa-miR-4465	CLIP-seq
MIRT1341976	hsa-miR-4720-3p	CLIP-seq
MIRT1341977	hsa-miR-4804-3p	CLIP-seq
MIRT1341978	hsa-miR-548q	CLIP-seq
MIRT1341979	hsa-miR-609	CLIP-seq
MIRT2101214	hsa-miR-1303	CLIP-seq
MIRT2101215	hsa-miR-4795-3p	CLIP-seq
MIRT1341964	hsa-miR-1256	CLIP-seq
MIRT1341966	hsa-miR-183	CLIP-seq
MIRT1341967	hsa-miR-203	CLIP-seq
MIRT1341968	hsa-miR-2052	CLIP-seq
MIRT1341971	hsa-miR-3676	CLIP-seq
MIRT2325594	hsa-miR-4717-3p	CLIP-seq
MIRT2459205	hsa-miR-1231	CLIP-seq
MIRT2459206	hsa-miR-219-1-3p	CLIP-seq
MIRT2459207	hsa-miR-3174	CLIP-seq
MIRT2459208	hsa-miR-346	CLIP-seq
MIRT2459209	hsa-miR-4288	CLIP-seq
MIRT2459210	hsa-miR-4418	CLIP-seq
MIRT2459211	hsa-miR-4709-3p	CLIP-seq
MIRT2459212	hsa-miR-509-3-5p	CLIP-seq
MIRT2459213	hsa-miR-509-5p	CLIP-seq
MIRT2459214	hsa-miR-571	CLIP-seq
MIRT2459215	hsa-miR-632	CLIP-seq
MIRT2459205	hsa-miR-1231	CLIP-seq
MIRT2459208	hsa-miR-346	CLIP-seq
MIRT2459209	hsa-miR-4288	CLIP-seq
MIRT2459215	hsa-miR-632	CLIP-seq
MIRT2621308	hsa-miR-103b	CLIP-seq
MIRT2621309	hsa-miR-1183	CLIP-seq
MIRT1341964	hsa-miR-1256	CLIP-seq
MIRT2621310	hsa-miR-1258	CLIP-seq
MIRT2621311	hsa-miR-1296	CLIP-seq
MIRT1341966	hsa-miR-183	CLIP-seq
MIRT2621312	hsa-miR-1915	CLIP-seq
MIRT2621313	hsa-miR-194	CLIP-seq
MIRT1341967	hsa-miR-203	CLIP-seq
MIRT1341968	hsa-miR-2052	CLIP-seq
MIRT2459206	hsa-miR-219-1-3p	CLIP-seq
MIRT2621314	hsa-miR-219-2-3p	CLIP-seq
MIRT2621315	hsa-miR-2276	CLIP-seq
MIRT2621316	hsa-miR-2909	CLIP-seq
MIRT2621317	hsa-miR-3129-3p	CLIP-seq
MIRT2621318	hsa-miR-3143	CLIP-seq
MIRT2621319	hsa-miR-3162-3p	CLIP-seq
MIRT2621320	hsa-miR-3163	CLIP-seq
MIRT2459207	hsa-miR-3174	CLIP-seq
MIRT2621321	hsa-miR-3183	CLIP-seq
MIRT2621322	hsa-miR-3607-3p	CLIP-seq
MIRT2621323	hsa-miR-3614-3p	CLIP-seq
MIRT2621324	hsa-miR-3653	CLIP-seq
MIRT2621325	hsa-miR-3658	CLIP-seq
MIRT1341971	hsa-miR-3676	CLIP-seq
MIRT2621326	hsa-miR-376c	CLIP-seq
MIRT2621327	hsa-miR-3929	CLIP-seq
MIRT2621328	hsa-miR-4265	CLIP-seq
MIRT2621329	hsa-miR-4296	CLIP-seq
MIRT2621330	hsa-miR-4322	CLIP-seq
MIRT2459210	hsa-miR-4418	CLIP-seq
MIRT2621331	hsa-miR-4419b	CLIP-seq
MIRT2621332	hsa-miR-4436b-3p	CLIP-seq
MIRT2621333	hsa-miR-4446-5p	CLIP-seq
MIRT2621334	hsa-miR-4478	CLIP-seq
MIRT2621335	hsa-miR-4645-5p	CLIP-seq
MIRT2621336	hsa-miR-4662a-5p	CLIP-seq
MIRT2621337	hsa-miR-4673	CLIP-seq
MIRT2621338	hsa-miR-4688	CLIP-seq
MIRT2621339	hsa-miR-4696	CLIP-seq
MIRT2459211	hsa-miR-4709-3p	CLIP-seq
MIRT2621340	hsa-miR-4711-3p	CLIP-seq
MIRT2325594	hsa-miR-4717-3p	CLIP-seq
MIRT2621341	hsa-miR-4723-3p	CLIP-seq
MIRT2621342	hsa-miR-4726-3p	CLIP-seq
MIRT2621343	hsa-miR-4729	CLIP-seq
MIRT2621344	hsa-miR-4742-5p	CLIP-seq
MIRT2621345	hsa-miR-4755-5p	CLIP-seq
MIRT2621346	hsa-miR-4761-3p	CLIP-seq
MIRT2621347	hsa-miR-4796-5p	CLIP-seq
MIRT2459212	hsa-miR-509-3-5p	CLIP-seq
MIRT2459213	hsa-miR-509-5p	CLIP-seq
MIRT2621348	hsa-miR-543	CLIP-seq
MIRT2621349	hsa-miR-548ag	CLIP-seq
MIRT2621350	hsa-miR-548ai	CLIP-seq
MIRT2621351	hsa-miR-548m	CLIP-seq
MIRT2459214	hsa-miR-571	CLIP-seq
MIRT2621352	hsa-miR-576-3p	CLIP-seq
MIRT2621353	hsa-miR-581	CLIP-seq
MIRT2621354	hsa-miR-875-5p	CLIP-seq
MIRT2621308	hsa-miR-103b	CLIP-seq
MIRT2621309	hsa-miR-1183	CLIP-seq
MIRT1341964	hsa-miR-1256	CLIP-seq
MIRT2621310	hsa-miR-1258	CLIP-seq
MIRT2621311	hsa-miR-1296	CLIP-seq
MIRT1341966	hsa-miR-183	CLIP-seq
MIRT2621312	hsa-miR-1915	CLIP-seq
MIRT2621313	hsa-miR-194	CLIP-seq
MIRT1341967	hsa-miR-203	CLIP-seq
MIRT1341968	hsa-miR-2052	CLIP-seq
MIRT2459206	hsa-miR-219-1-3p	CLIP-seq
MIRT2621314	hsa-miR-219-2-3p	CLIP-seq
MIRT2621315	hsa-miR-2276	CLIP-seq
MIRT2621316	hsa-miR-2909	CLIP-seq
MIRT2621318	hsa-miR-3143	CLIP-seq
MIRT2621319	hsa-miR-3162-3p	CLIP-seq
MIRT2459207	hsa-miR-3174	CLIP-seq
MIRT2621322	hsa-miR-3607-3p	CLIP-seq
MIRT2621323	hsa-miR-3614-3p	CLIP-seq
MIRT2690558	hsa-miR-365	CLIP-seq
MIRT2621324	hsa-miR-3653	CLIP-seq
MIRT2621325	hsa-miR-3658	CLIP-seq
MIRT1341971	hsa-miR-3676	CLIP-seq
MIRT2621326	hsa-miR-376c	CLIP-seq
MIRT2621327	hsa-miR-3929	CLIP-seq
MIRT2459210	hsa-miR-4418	CLIP-seq
MIRT2621331	hsa-miR-4419b	CLIP-seq
MIRT2621332	hsa-miR-4436b-3p	CLIP-seq
MIRT2621333	hsa-miR-4446-5p	CLIP-seq
MIRT2621334	hsa-miR-4478	CLIP-seq
MIRT2621335	hsa-miR-4645-5p	CLIP-seq
MIRT2621337	hsa-miR-4673	CLIP-seq
MIRT2621338	hsa-miR-4688	CLIP-seq
MIRT2621339	hsa-miR-4696	CLIP-seq
MIRT2459211	hsa-miR-4709-3p	CLIP-seq
MIRT2621340	hsa-miR-4711-3p	CLIP-seq
MIRT2325594	hsa-miR-4717-3p	CLIP-seq
MIRT2621342	hsa-miR-4726-3p	CLIP-seq
MIRT2621343	hsa-miR-4729	CLIP-seq
MIRT2621344	hsa-miR-4742-5p	CLIP-seq
MIRT2621345	hsa-miR-4755-5p	CLIP-seq
MIRT2621346	hsa-miR-4761-3p	CLIP-seq
MIRT2621347	hsa-miR-4796-5p	CLIP-seq
MIRT2459212	hsa-miR-509-3-5p	CLIP-seq
MIRT2459213	hsa-miR-509-5p	CLIP-seq
MIRT2621348	hsa-miR-543	CLIP-seq
MIRT2621349	hsa-miR-548ag	CLIP-seq
MIRT2621350	hsa-miR-548ai	CLIP-seq
MIRT2621351	hsa-miR-548m	CLIP-seq
MIRT2459214	hsa-miR-571	CLIP-seq
MIRT2621352	hsa-miR-576-3p	CLIP-seq

Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	18945944
GO:0001501	Process	Skeletal system development	IEA
GO:0002092	Process	Positive regulation of receptor internalization	IDA	16151791
GO:0005515	Function	Protein binding	IPI	15607035, 32296183, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	14760084
GO:0005634	Component	Nucleus	IDA	18938133
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	11793365, 14760084, 18938133
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	14760084, 15705870
GO:0009725	Process	Response to hormone	NAS	10211996
GO:0009887	Process	Animal organ morphogenesis	IEA
GO:0009986	Component	Cell surface	IDA	14760084
GO:0010628	Process	Positive regulation of gene expression	IDA	18938133
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0017147	Function	Wnt-protein binding	IBA
GO:0017147	Function	Wnt-protein binding	IDA	17462603
GO:0017147	Function	Wnt-protein binding	IPI	17462603
GO:0017147	Function	Wnt-protein binding	NAS	24431302
GO:0030154	Process	Cell differentiation	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	NAS	24431302
GO:0030510	Process	Regulation of BMP signaling pathway	IEA
GO:0030510	Process	Regulation of BMP signaling pathway	ISS
GO:0035567	Process	Non-canonical Wnt signaling pathway	IBA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IMP	15705870
GO:0045606	Process	Positive regulation of epidermal cell differentiation	IDA	18938133
GO:0055062	Process	Phosphate ion homeostasis	IDA	12952927, 16151791
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060349	Process	Bone morphogenesis	IEA
GO:0060349	Process	Bone morphogenesis	IMP	27355534
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IDA	18945944
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IMP	14760084, 15705870
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IGI	18166153
GO:1902174	Process	Positive regulation of keratinocyte apoptotic process	IDA	18938133
GO:2000051	Process	Negative regulation of non-canonical Wnt signaling pathway	IEA
GO:2000051	Process	Negative regulation of non-canonical Wnt signaling pathway	ISS
GO:2000119	Process	Negative regulation of sodium-dependent phosphate transport	IDA	12952927, 16151791

MIM	HGNC	e!Ensembl
606570	10778	ENSG00000106483

Q6FHJ7

Protein name

Secreted frizzled-related protein 4 (sFRP-4) (Frizzled protein, human endometrium) (FrpHE)

Protein function

Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types (By similarity). SFRP4 plays a role in

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01392	Fz	24 → 133	Fz domain	Domain
PF01759	NTR	188 → 289	UNC-6/NTR/C345C module	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in mesenchymal cells. Highly expressed in the stroma of proliferative endometrium. Expressed in cardiomyocytes. Shows moderate to strong expression in ovarian tumors with expression increasing as the tumor stage increases. In

Sequence

MFLSILVALCLWLHLALGVRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQ
YEELVDVNCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWP
ESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERPLDVDCKRLSPDRCKC
KKVKPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFKSSSPIPRTQVPLITN
SSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQRRTVQD
KKKTAGRTSRSNPPKPKGKPPAPKPASPKKNIKTRSAQKRTNPKRV

Sequence length

346

Interactions

View interactions

	KEGG
	Wnt signaling pathway

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Pyle metaphyseal dysplasia	Pathogenic; Likely pathogenic	rs879255603, rs755007671, rs879253778, rs1344808304, rs758308395	RCV000234979 RCV000234991 RCV000234974 RCV001271113 RCV001271112

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
SFRP4-related disorder	Benign; Likely benign	rs1802073, rs1802074, rs1132553, rs1132552, rs780871022, rs546932583	RCV003976046 RCV003984111 RCV003984112 RCV003976195 RCV003958489 RCV003933460

Show/Hide Text Mining Associations (70)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	19513747
Adenocarcinoma Mucinous	Inhibit	23039795
Adenoma	Associate	17131472, 21154739
Adenomyosis	Associate	36532077, 38239300
Alopecia	Stimulate	35007355
Androgen Insensitivity Syndrome	Associate	31671693
Atherosclerosis	Associate	29037197
Atrial Fibrillation	Associate	36295481
Brain Neoplasms	Associate	24406045
Breast Neoplasms	Associate	22037257, 32990024
Calcinosis Cutis	Associate	29079735
Cancer Familial with In Vitro Radioresistance	Associate	32046444
Carcinogenesis	Associate	28637297, 33361638
Carcinoma Endometrioid	Associate	21709441, 26397159
Carcinoma Hepatocellular	Associate	20532728
Carcinoma Hepatocellular	Inhibit	33760186
Carcinoma Ovarian Epithelial	Associate	23326605
Carcinoma Squamous Cell	Associate	26394929
Cardiomyopathy Dilated	Associate	38460409
Cell Transformation Neoplastic	Inhibit	25714610
Cognitive Dysfunction	Associate	29037197
Colitis Ulcerative	Associate	30473377
Colorectal Neoplasms	Associate	17131472, 25107489, 33891491, 38151510
Coronary Artery Disease	Associate	29037197
Craniosynostoses	Associate	22028906
Diabetes Mellitus	Associate	35290144, 40640313
Dupuytren Contracture	Associate	21732829, 28886342, 34573275
Dysmenorrhea	Associate	38239300
Endometrial Neoplasms	Associate	26397159, 29693365, 32555395
Fibrosis	Associate	32219160
Gallbladder Neoplasms	Associate	26715268
Glioma	Associate	24406045, 26712519
Graves Ophthalmopathy	Associate	40640313
Heart Failure	Associate	36295481, 37275875, 37390254
Hypoxia	Stimulate	35290144
Inflammation	Associate	23824412, 25322919
Inflammation	Inhibit	35290144
Insulin Resistance	Associate	25322919
Keratoconus	Associate	23825088
Lead Poisoning Nervous System	Inhibit	35290144
Leiomyoma	Associate	28637297
Leukemia Myeloid Acute	Associate	20795789
Lung Neoplasms	Associate	20849603, 35101137, 37275875
Lymphatic Metastasis	Stimulate	32677026
Neoplasms	Associate	15579438, 18542073, 20849603, 21638518, 21709441, 23039795, 24577895, 24925057, 25107489, 26394929, 28152305, 29079735, 30473377, 32527205, 32677026, 33760186, 36190948, 39984992 View all (3 more)
Neoplasms	Inhibit	17131472, 21999220, 22363760
Neoplasms	Stimulate	39511287
Neoplasms Adipose Tissue	Associate	25322919
Neuroendocrine Tumors	Associate	25058880
Obesity	Stimulate	25322919
Osteoarthritis	Associate	24894724, 37390254
Ovarian Neoplasms	Associate	22363760, 23039795
Ovarian Neoplasms	Inhibit	23326605
Parathyroid Neoplasms	Associate	21638518
Polycystic Kidney Autosomal Dominant	Associate	30403162
Polyps	Associate	18542073, 24925057
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	22095226
Prostate Cancer Hereditary 7	Associate	29079735
Prostatic Neoplasms	Associate	22915211, 29079735, 32677026, 33361638, 36124532, 39511287
Prostatitis	Associate	39511287
Pterygium	Associate	36187094
Reperfusion Injury	Associate	35290144
Retinal Dysplasia	Associate	21154739, 30473377
Scleroderma Localized	Associate	37372943
Skin Diseases	Associate	32219160
Stomach Neoplasms	Associate	18158559, 28152305, 33277667
Thyroid Neoplasms	Associate	39984992
Urinary Bladder Neoplasms	Associate	24577895
Uterine Cervical Neoplasms	Associate	19513747, 32527205, 39346086, 39372720
Uterine Diseases	Associate	21709441

SFRP4 (secreted frizzled related protein 4)