Gene Gene information from NCBI Gene database.
Entrez ID 64236
Gene name PDZ and LIM domain 2
Gene symbol PDLIM2
Synonyms (NCBI Gene)
MYSTIQUESLIM
Chromosome 8
Chromosome location 8p21.3
Summary This gene encodes a member of the ALP subfamily of PDZ-LIM domain proteins. The encoded protein suppresses anchorage-dependent growth and promotes cell migration and adhesion through interactions with the actin cytoskeleton via the PDZ domain. The encoded
miRNA miRNA information provided by mirtarbase database.
290
miRTarBase ID miRNA Experiments Reference
MIRT041815 hsa-miR-484 CLASH 23622248
MIRT1222083 hsa-miR-130a CLIP-seq
MIRT1222084 hsa-miR-130b CLIP-seq
MIRT1222085 hsa-miR-1827 CLIP-seq
MIRT1222086 hsa-miR-301a CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
GO ID Ontology Definition Evidence Reference
GO:0001725 Component Stress fiber IBA
GO:0003779 Function Actin binding IBA
GO:0005515 Function Protein binding IPI 21044950, 32296183
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609722 13992 ENSG00000120913
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96JY6
Protein name PDZ and LIM domain protein 2 (PDZ-LIM protein mystique)
Protein function Probable adapter protein located at the actin cytoskeleton that promotes cell attachment. Necessary for the migratory capacity of epithelial cells. Overexpression enhances cell adhesion to collagen and fibronectin and suppresses anchorage indepe
PDB 2PA1 , 3PDV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00595 PDZ 3 81 PDZ domain Domain
PF15936 DUF4749 193 259 Domain of unknown function (DUF4749) Family
PF00412 LIM 286 342 LIM domain Domain
Sequence
MALTVDVAGPAPWGFRITGGRDFHTPIMVTKVAERGKAKDADLRPGDIIVAINGESAEGM
LHAEAQSKIRQSPSPLRLQLD
RSQATSPGQTNGDSSLEVLATRFQGSVRTYTESQSSLRS
SYSSPTSLSPRAGSPFSPPPSSSSLTGEAAISRSFQSLACSPGLPAADRLSYSGRPGSRQ
AGLGRAGDSAVLVLPPSPGPRSSRPSMDSEGGSLLLDEDSEVFKMLQENREGRAAPRQSS
SFRLLQEALEAEERGGTPA
FLPSSLSPQSSLPASRALATPPKLHTCEKCSTSIANQAVRI
QEGRYRHPGCYTCADCGLNLKMRGHFWVGDELYCEKHARQRY
SAPATLSSRA
Sequence length 352
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Cytoskeleton in muscle cells  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
PARKINSON DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Arthritis Rheumatoid Inhibit 34713769
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Associate 24863845
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Associate 25681443
★☆☆☆☆
Found in Text Mining only
Carcinoma Renal Cell Associate 35121770
★☆☆☆☆
Found in Text Mining only
Colonic Neoplasms Associate 35121770
★☆☆☆☆
Found in Text Mining only
Esophageal Neoplasms Associate 31222932
★☆☆☆☆
Found in Text Mining only
Esophageal Squamous Cell Carcinoma Associate 31222932
★☆☆☆☆
Found in Text Mining only
Hereditary leiomyomatosis and renal cell cancer Associate 27538486
★☆☆☆☆
Found in Text Mining only
Hodgkin Disease Associate 27538486
★☆☆☆☆
Found in Text Mining only
Inflammation Associate 27538486
★☆☆☆☆
Found in Text Mining only