MS4A6A (membrane spanning 4-domains A6A)

Gene

• Entrez ID: 64231
• Gene name: Membrane spanning 4-domains A6A
• Gene symbol: MS4A6A
• Synonyms (NCBI Gene): 4SPAN3, 4SPAN3.2, CD20L3, CDA01, MS4A6, MST090, MSTP090
• Chromosome: 11
• Chromosome location: 11q12.2
• Summary: This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2046228	hsa-miR-3192	CLIP-seq
MIRT2046229	hsa-miR-4314	CLIP-seq
MIRT2046230	hsa-miR-4424	CLIP-seq
MIRT2046231	hsa-miR-4646-5p	CLIP-seq
MIRT2046232	hsa-miR-491-3p	CLIP-seq
MIRT2046233	hsa-miR-501-3p	CLIP-seq
MIRT2046234	hsa-miR-502-3p	CLIP-seq
MIRT2275335	hsa-miR-3120-5p	CLIP-seq
MIRT2046228	hsa-miR-3192	CLIP-seq
MIRT2046229	hsa-miR-4314	CLIP-seq
MIRT2046231	hsa-miR-4646-5p	CLIP-seq
MIRT2275336	hsa-miR-4778-5p	CLIP-seq
MIRT2454526	hsa-miR-3140-3p	CLIP-seq
MIRT2454526	hsa-miR-3140-3p	CLIP-seq
MIRT2454526	hsa-miR-3140-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005802	Component	Trans-Golgi network	IBA
GO:0005802	Component	Trans-Golgi network	IDA	23874341
GO:0005886	Component	Plasma membrane	IBA
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0016020	Component	Membrane	IEA

Other IDs

• MIM: 606548
• HGNC: 13375
• e!Ensembl: ENSG00000110077

Protein

• UniProt ID: Q9H2W1
• Protein name: Membrane-spanning 4-domains subfamily A member 6A (CD20 antigen-like 3) (Four-span transmembrane protein 3)
• Protein function: May be involved in signal transduction as a component of a multimeric receptor complex.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04103	CD20	47 → 208	CD20-like family	Family

• Tissue specificity: TISSUE SPECIFICITY: Variable expression in some B-cell, myelomonocytic, and erythroleukemia cell lines.
• Sequence:

  MTSQPVPNETIIVLPSNVINFSQAEKPEPTNQGQDSLKKHLHAEIKVIGTIQILCGMMVL
  SLGIILASASFSPNFTQVTSTLLNSAYPFIGPFFFIISGSLSIATEKRLTKLLVHSSLVG
  SILSALSALVGFIILSVKQATLNPASLQCELDKNNIPTRSYVSYFYHDSLYTTDCYTAKA
  SLAGTLSLMLICTLLEFCLAVLTAVLRWKQAYSDFPGSVLFLPHSYIGNSGMSSKMTHDC
  GYEELLTS

• Sequence length: 248