Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6423
Gene name	Secreted frizzled related protein 2
Gene symbol	SFRP2
Synonyms (NCBI Gene)	FRP-2SARP1SDF-5
Chromosome	4
Chromosome location	4q31.3
Summary	This gene encodes a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. Methylation of this gene is a potential marker for the p

128

Show/Hide all (128)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003607	hsa-miR-29a-3p	Luciferase reporter assayqRT-PCRWestern blot	20551325
MIRT006749	hsa-miR-218-5p	Luciferase reporter assay	21501592
MIRT006749	hsa-miR-218-5p	Luciferase reporter assay	21501592
MIRT006749	hsa-miR-218-5p	Luciferase reporter assay	21501592
MIRT006749	hsa-miR-218-5p	Luciferase reporter assay	23060446
MIRT006749	hsa-miR-218-5p	Luciferase reporter assayqRT-PCRWestern blot	24091133
MIRT006749	hsa-miR-218-5p	ELISAImmunohistochemistryLuciferase reporter assayqRT-PCR	27738322
MIRT006749	hsa-miR-218-5p	ELISAImmunohistochemistryLuciferase reporter assayqRT-PCR	27738322
MIRT734051	hsa-miR-22-3p	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blotting	31891366
MIRT1341933	hsa-miR-1	CLIP-seq
MIRT1341934	hsa-miR-106a	CLIP-seq
MIRT1341935	hsa-miR-106b	CLIP-seq
MIRT1341936	hsa-miR-17	CLIP-seq
MIRT1341937	hsa-miR-206	CLIP-seq
MIRT1341938	hsa-miR-20a	CLIP-seq
MIRT1341939	hsa-miR-20b	CLIP-seq
MIRT1341940	hsa-miR-3200-5p	CLIP-seq
MIRT1341941	hsa-miR-3609	CLIP-seq
MIRT1341942	hsa-miR-3673	CLIP-seq
MIRT1341943	hsa-miR-3689a-5p	CLIP-seq
MIRT1341944	hsa-miR-3689b	CLIP-seq
MIRT1341945	hsa-miR-3689e	CLIP-seq
MIRT1341946	hsa-miR-3689f	CLIP-seq
MIRT1341947	hsa-miR-409-3p	CLIP-seq
MIRT1341948	hsa-miR-4264	CLIP-seq
MIRT1341949	hsa-miR-4432	CLIP-seq
MIRT1341950	hsa-miR-4666-5p	CLIP-seq
MIRT1341951	hsa-miR-4699-3p	CLIP-seq
MIRT1341952	hsa-miR-4766-5p	CLIP-seq
MIRT1341953	hsa-miR-4796-3p	CLIP-seq
MIRT1341954	hsa-miR-4797-3p	CLIP-seq
MIRT1341955	hsa-miR-499-5p	CLIP-seq
MIRT1341956	hsa-miR-519d	CLIP-seq
MIRT1341957	hsa-miR-548ah	CLIP-seq
MIRT1341958	hsa-miR-582-5p	CLIP-seq
MIRT1341959	hsa-miR-610	CLIP-seq
MIRT1341960	hsa-miR-613	CLIP-seq
MIRT1341961	hsa-miR-627	CLIP-seq
MIRT1341962	hsa-miR-924	CLIP-seq
MIRT1341963	hsa-miR-93	CLIP-seq
MIRT2101211	hsa-miR-548ag	CLIP-seq
MIRT2101212	hsa-miR-548ai	CLIP-seq
MIRT2101213	hsa-miR-548m	CLIP-seq
MIRT2621273	hsa-miR-1203	CLIP-seq
MIRT2621274	hsa-miR-122	CLIP-seq
MIRT2621275	hsa-miR-128	CLIP-seq
MIRT2621276	hsa-miR-1292	CLIP-seq
MIRT2621277	hsa-miR-1323	CLIP-seq
MIRT2621278	hsa-miR-2110	CLIP-seq
MIRT2621279	hsa-miR-218	CLIP-seq
MIRT2621280	hsa-miR-224	CLIP-seq
MIRT2621281	hsa-miR-27a	CLIP-seq
MIRT2621282	hsa-miR-27b	CLIP-seq
MIRT2621283	hsa-miR-3065-5p	CLIP-seq
MIRT2621284	hsa-miR-3150a-3p	CLIP-seq
MIRT2621285	hsa-miR-3160-3p	CLIP-seq
MIRT2621286	hsa-miR-3194-3p	CLIP-seq
MIRT2621287	hsa-miR-3672	CLIP-seq
MIRT2621288	hsa-miR-3691-3p	CLIP-seq
MIRT2621289	hsa-miR-371b-5p	CLIP-seq
MIRT2621290	hsa-miR-4271	CLIP-seq
MIRT2621291	hsa-miR-4272	CLIP-seq
MIRT2621292	hsa-miR-4300	CLIP-seq
MIRT2621293	hsa-miR-4463	CLIP-seq
MIRT2621294	hsa-miR-4468	CLIP-seq
MIRT2621295	hsa-miR-4650-5p	CLIP-seq
MIRT2621296	hsa-miR-4690-5p	CLIP-seq
MIRT2621297	hsa-miR-4725-3p	CLIP-seq
MIRT2621298	hsa-miR-495	CLIP-seq
MIRT2621299	hsa-miR-516b	CLIP-seq
MIRT2621300	hsa-miR-522	CLIP-seq
MIRT2621301	hsa-miR-548o	CLIP-seq
MIRT2621302	hsa-miR-574-5p	CLIP-seq
MIRT2621303	hsa-miR-636	CLIP-seq
MIRT2621304	hsa-miR-646	CLIP-seq
MIRT2621305	hsa-miR-648	CLIP-seq
MIRT2621306	hsa-miR-888	CLIP-seq
MIRT2621307	hsa-miR-920	CLIP-seq
MIRT1341934	hsa-miR-106a	CLIP-seq
MIRT1341935	hsa-miR-106b	CLIP-seq
MIRT2621273	hsa-miR-1203	CLIP-seq
MIRT2621274	hsa-miR-122	CLIP-seq
MIRT2621275	hsa-miR-128	CLIP-seq
MIRT2621276	hsa-miR-1292	CLIP-seq
MIRT2621277	hsa-miR-1323	CLIP-seq
MIRT1341936	hsa-miR-17	CLIP-seq
MIRT1341938	hsa-miR-20a	CLIP-seq
MIRT1341939	hsa-miR-20b	CLIP-seq
MIRT2621278	hsa-miR-2110	CLIP-seq
MIRT2621279	hsa-miR-218	CLIP-seq
MIRT2621280	hsa-miR-224	CLIP-seq
MIRT2621281	hsa-miR-27a	CLIP-seq
MIRT2621282	hsa-miR-27b	CLIP-seq
MIRT2621283	hsa-miR-3065-5p	CLIP-seq
MIRT2621284	hsa-miR-3150a-3p	CLIP-seq
MIRT2621285	hsa-miR-3160-3p	CLIP-seq
MIRT2621286	hsa-miR-3194-3p	CLIP-seq
MIRT1341941	hsa-miR-3609	CLIP-seq
MIRT2621287	hsa-miR-3672	CLIP-seq
MIRT2621288	hsa-miR-3691-3p	CLIP-seq
MIRT2621289	hsa-miR-371b-5p	CLIP-seq
MIRT2621290	hsa-miR-4271	CLIP-seq
MIRT2621291	hsa-miR-4272	CLIP-seq
MIRT2621292	hsa-miR-4300	CLIP-seq
MIRT2690554	hsa-miR-433	CLIP-seq
MIRT2621293	hsa-miR-4463	CLIP-seq
MIRT2621294	hsa-miR-4468	CLIP-seq
MIRT2621295	hsa-miR-4650-5p	CLIP-seq
MIRT2690555	hsa-miR-4661-5p	CLIP-seq
MIRT2621296	hsa-miR-4690-5p	CLIP-seq
MIRT2621297	hsa-miR-4725-3p	CLIP-seq
MIRT1341953	hsa-miR-4796-3p	CLIP-seq
MIRT2621298	hsa-miR-495	CLIP-seq
MIRT2621299	hsa-miR-516b	CLIP-seq
MIRT1341956	hsa-miR-519d	CLIP-seq
MIRT2621300	hsa-miR-522	CLIP-seq
MIRT1341957	hsa-miR-548ah	CLIP-seq
MIRT2690556	hsa-miR-548c-3p	CLIP-seq
MIRT2621301	hsa-miR-548o	CLIP-seq
MIRT2621302	hsa-miR-574-5p	CLIP-seq
MIRT1341959	hsa-miR-610	CLIP-seq
MIRT2621303	hsa-miR-636	CLIP-seq
MIRT2621304	hsa-miR-646	CLIP-seq
MIRT2621305	hsa-miR-648	CLIP-seq
MIRT2690557	hsa-miR-664	CLIP-seq
MIRT2621306	hsa-miR-888	CLIP-seq
MIRT2621307	hsa-miR-920	CLIP-seq
MIRT1341963	hsa-miR-93	CLIP-seq

101

Show/Hide all (101)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001558	Process	Regulation of cell growth	IEA
GO:0001569	Process	Branching involved in blood vessel morphogenesis	IEA
GO:0001569	Process	Branching involved in blood vessel morphogenesis	ISS
GO:0001756	Process	Somitogenesis	IEA
GO:0001843	Process	Neural tube closure	IEA
GO:0001968	Function	Fibronectin binding	ISS
GO:0002063	Process	Chondrocyte development	IEA
GO:0003151	Process	Outflow tract morphogenesis	IMP	19593212
GO:0003214	Process	Cardiac left ventricle morphogenesis	IMP	19593212
GO:0005178	Function	Integrin binding	ISS
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	10980594
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	ISS
GO:0006915	Process	Apoptotic process	IEA
GO:0007267	Process	Cell-cell signaling	ISS
GO:0007501	Process	Mesodermal cell fate specification	IEA
GO:0007584	Process	Response to nutrient	IEA
GO:0008047	Function	Enzyme activator activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	10980594
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	20208569
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	17848950
GO:0008584	Process	Male gonad development	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	ISS	10980594
GO:0010659	Process	Cardiac muscle cell apoptotic process	IEA
GO:0010667	Process	Negative regulation of cardiac muscle cell apoptotic process	IEA
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IDA	19095296
GO:0010975	Process	Regulation of neuron projection development	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0017147	Function	Wnt-protein binding	IBA
GO:0017147	Function	Wnt-protein binding	IEA
GO:0017147	Function	Wnt-protein binding	NAS	24431302
GO:0021915	Process	Neural tube development	IEA
GO:0030111	Process	Regulation of Wnt signaling pathway	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IDA	20208569
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	NAS	24431302
GO:0030199	Process	Collagen fibril organization	IEA
GO:0030307	Process	Positive regulation of cell growth	IEA
GO:0030307	Process	Positive regulation of cell growth	ISS	10980594
GO:0030308	Process	Negative regulation of cell growth	IDA	20208569
GO:0030336	Process	Negative regulation of cell migration	IEA
GO:0030336	Process	Negative regulation of cell migration	ISS	10980594
GO:0030509	Process	BMP signaling pathway	IEA
GO:0030514	Process	Negative regulation of BMP signaling pathway	IEA
GO:0031012	Component	Extracellular matrix	ISS
GO:0033630	Process	Positive regulation of cell adhesion mediated by integrin	ISS
GO:0035567	Process	Non-canonical Wnt signaling pathway	IBA
GO:0036342	Process	Post-anal tail morphogenesis	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042662	Process	Negative regulation of mesodermal cell fate specification	IEA
GO:0042733	Process	Embryonic digit morphogenesis	IEA
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IMP	17848950
GO:0045600	Process	Positive regulation of fat cell differentiation	IDA	12055200
GO:0045669	Process	Positive regulation of osteoblast differentiation	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045766	Process	Positive regulation of angiogenesis	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	19095296
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046546	Process	Development of primary male sexual characteristics	IEA
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048018	Function	Receptor ligand activity	ISS
GO:0048546	Process	Digestive tract morphogenesis	IEA
GO:0048866	Process	Stem cell fate specification	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IDA	19095296
GO:0050732	Process	Negative regulation of peptidyl-tyrosine phosphorylation	ISS	10980594
GO:0051216	Process	Cartilage development	IEA
GO:0060028	Process	Convergent extension involved in axis elongation	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	ISS
GO:0061056	Process	Sclerotome development	IEA
GO:0061056	Process	Sclerotome development	ISS
GO:0061133	Function	Endopeptidase activator activity	IEA
GO:0061185	Process	Negative regulation of dermatome development	IEA
GO:0061185	Process	Negative regulation of dermatome development	ISS
GO:0071425	Process	Hematopoietic stem cell proliferation	IEA
GO:0071425	Process	Hematopoietic stem cell proliferation	ISS
GO:0071481	Process	Cellular response to X-ray	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IDA	17471511
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090175	Process	Regulation of establishment of planar polarity	IEA
GO:0090244	Process	Wnt signaling pathway involved in somitogenesis	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	ISS
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IEA
GO:1902230	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage	ISS
GO:1904956	Process	Regulation of midbrain dopaminergic neuron differentiation	IEA
GO:2000035	Process	Regulation of stem cell division	IEA
GO:2000035	Process	Regulation of stem cell division	ISS

MIM	HGNC	e!Ensembl
604157	10777	ENSG00000145423

Q96HF1

Protein name

Secreted frizzled-related protein 2 (FRP-2) (sFRP-2) (Secreted apoptosis-related protein 1) (SARP-1)

Protein function

Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP2 may be important for eye retinal

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01392	Fz	40 → 150	Fz domain	Domain
PF01759	NTR	187 → 285	UNC-6/NTR/C345C module	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in adipose tissue, heart, brain, skeletal muscle, pancreas, thymus, prostate, testis, ovary, small intestine and colon. Highest levels in adipose tissue, small intestine and colon. {ECO:0000269|PubMed:9391078, ECO:0000269|Pub

Sequence

MLQGPGSLLLLFLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRL
PNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQ
VKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKND
DDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLK
DSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC

Sequence length

295

Interactions

View interactions

	KEGG
	Wnt signaling pathway

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Anophthalmia-microphthalmia syndrome	Conflicting classifications of pathogenicity	rs770485715	RCV000207374

Show/Hide Text Mining Associations (88)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
ACTH Secreting Pituitary Adenoma	Inhibit	29620167
Adenocarcinoma	Associate	19513747, 26482433
Adenocarcinoma	Inhibit	37999144
Adenocarcinoma Mucinous	Associate	20686305
Adenoma	Inhibit	17131472
Adenoma	Associate	17352030, 19700653, 21154739, 25432628, 25759530, 27896617, 28753106, 29620167, 30578081, 34477243
Alopecia	Associate	35862273
Alzheimer Disease	Associate	26482433
Astrocytoma	Associate	32647207
Breast Neoplasms	Associate	18283316, 18403594, 18990230, 19513569, 22026417
Breast Neoplasms	Inhibit	22655072
Breast Neoplasms	Stimulate	32990024
Carcinogenesis	Associate	19700653, 21709441
Carcinoma Basal Cell	Associate	17273163
Carcinoma Endometrioid	Associate	21709441
Carcinoma Hepatocellular	Associate	24947038, 26960688
Carcinoma Non Small Cell Lung	Associate	28422739, 37999144
Carcinoma Renal Cell	Associate	23975733
Carcinoma Squamous Cell	Associate	26394929
Carcinoma Squamous Cell	Inhibit	37999144
Cicatrix Hypertrophic	Associate	23226515
Colitis Ulcerative	Associate	18716850, 30473377
Colorectal Neoplasms	Associate	17131472, 17352030, 18203283, 19700653, 20686305, 21123457, 21709714, 22703586, 24852431, 24876755, 25107489, 25759530, 25991403, 26291085, 26482433 View all (21 more)
Colorectal Neoplasms Hereditary Nonpolyposis	Associate	25625843
Death	Associate	20795789
Endometrial Neoplasms	Associate	29949535, 36991319
Endometriosis	Associate	29462326, 36991319
Esophageal Neoplasms	Inhibit	31578133
Esophageal Squamous Cell Carcinoma	Associate	21734802
Esophageal Squamous Cell Carcinoma	Inhibit	31578133
Fibrosis	Associate	24386373
Gastrointestinal Neoplasms	Associate	19700653
Glioblastoma	Associate	32647207, 34021259
Glioma	Associate	26337424, 38225203
Hepatitis C	Associate	24386373, 24947038
Hypertension	Associate	19593212
Hypertrophy Left Ventricular	Associate	19593212
Inflammation	Associate	37350578
Inflammatory Bowel Diseases	Associate	18716850
Insulin Resistance	Associate	32517740
Internal Hernia	Associate	37284741
Keloid	Inhibit	20555348
Keratoconus	Associate	23825088
Kidney Cortex Necrosis	Associate	38287102
Leukemia Lymphocytic Chronic B Cell	Associate	20495622
Leukemia Myeloid Acute	Associate	20795789, 25197341, 25734857
Leukemia Myeloid Acute	Inhibit	34083850
Liver Cirrhosis	Associate	24386373, 24947038
Lung Neoplasms	Associate	26323494
Lymphoproliferative Disorders	Stimulate	22175903
Mesothelioma Malignant	Associate	29386699
Mouth Neoplasms	Associate	25487617
Nasopharyngeal Carcinoma	Associate	30075814
Nasopharyngeal Neoplasms	Associate	10929762
Neoplasm Metastasis	Associate	32517740
Neoplasms	Inhibit	17131472, 19513747, 20686305, 23975733, 25725609, 27540971, 29386699, 29620167, 33107235
Neoplasms	Associate	17968429, 18990230, 19106645, 20069066, 21638518, 22175903, 23320751, 24947038, 25197341, 26291085, 26323494, 26394929, 26751775, 27114416, 28422739 View all (8 more)
Neoplasms	Stimulate	25432628, 37284741
Neoplasms Cystic Mucinous and Serous	Associate	25625843
Osteosarcoma	Associate	26628297
Ovarian Neoplasms	Associate	25625843, 32977853, 35741755, 37284741, 38069266
Pancreatic Neoplasms	Associate	27891190
Parathyroid Neoplasms	Associate	21638518
Pathologic Processes	Associate	29949535
Pituitary ACTH Hypersecretion	Associate	29620167
Plasmablastic Lymphoma	Associate	37105495
Pleural Diseases	Stimulate	37999144
Polyposis Syndrome Hereditary Mixed 1	Associate	28753106
Polyps	Associate	27221916
Precancerous Conditions	Associate	32517740
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	16192589
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	18537968
Prostatic Hyperplasia	Associate	22915211
Prostatic Intraepithelial Neoplasia	Inhibit	22915211
Prostatic Neoplasms	Associate	22175903, 22915211, 36552843
Pterygium	Associate	36187094
Pulmonary Disease Chronic Obstructive	Stimulate	21490961
Retinal Dysplasia	Associate	21154739, 30473377
Retinoblastoma	Associate	20069066
Spherocytosis Type 1	Associate	37922232
Squamous Cell Carcinoma of Head and Neck	Associate	29790687, 29900911
Stomach Neoplasms	Associate	19700653, 23942619, 28152305, 32379490, 33107235, 36578802
Thyroid Cancer Papillary	Associate	30614796
Thyroiditis	Associate	20976176
Turcot syndrome	Associate	30578081
Uterine Cervical Neoplasms	Associate	19513747, 23226515
Uterine Diseases	Associate	21709441
Weight Loss	Associate	30884788

SFRP2 (secreted frizzled related protein 2)