Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6422
Gene name Gene Name - the full gene name approved by the HGNC.	Secreted frizzled related protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SFRP1
Synonyms (NCBI Gene) Gene synonyms aliases	FRP, FRP-1, FRP1, FrzA, SARP2
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8p11.21
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. Members of this family act as soluble modulators of Wnt signaling; epigenetic silencing of SFRP genes lead

Show/Hide all(449)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017159	hsa-miR-335-5p	Microarray	18185580
MIRT052899	hsa-miR-1260b	Luciferase reporter assay, qRT-PCR, Western blot	23591200
MIRT052899	hsa-miR-1260b	Luciferase reporter assay, qRT-PCR, Western blot	23591200
MIRT438354	hsa-miR-206	Flow, qRT-PCR	24855559
MIRT438280	hsa-miR-127-3p	Luciferase reporter assay, qRT-PCR, Western blot	24517116
MIRT438280	hsa-miR-127-3p	Luciferase reporter assay, qRT-PCR, Western blot	24517116
MIRT052899	hsa-miR-1260b	Luciferase reporter assay, Western blot	24504368
MIRT438354	hsa-miR-206	Flow, qRT-PCR	24855559
MIRT438280	hsa-miR-127-3p	Luciferase reporter assay, qRT-PCR, Western blot	24517116
MIRT438280	hsa-miR-127-3p	Luciferase reporter assay, qRT-PCR, Western blot	24517116
MIRT052899	hsa-miR-1260b	Luciferase reporter assay, Western blot	24504368
MIRT448052	hsa-miR-504-5p	PAR-CLIP	22100165
MIRT448051	hsa-miR-10a-5p	PAR-CLIP	22100165
MIRT448050	hsa-miR-10b-5p	PAR-CLIP	22100165
MIRT448049	hsa-miR-4292	PAR-CLIP	22100165
MIRT448047	hsa-miR-6791-5p	PAR-CLIP	22100165
MIRT448048	hsa-miR-6852-5p	PAR-CLIP	22100165
MIRT448046	hsa-miR-4667-5p	PAR-CLIP	22100165
MIRT448045	hsa-miR-4700-5p	PAR-CLIP	22100165
MIRT448044	hsa-miR-8089	PAR-CLIP	22100165
MIRT448043	hsa-miR-146a-5p	PAR-CLIP	22100165
MIRT448042	hsa-miR-146b-5p	PAR-CLIP	22100165
MIRT448041	hsa-miR-7153-5p	PAR-CLIP	22100165
MIRT448040	hsa-miR-6878-5p	PAR-CLIP	22100165
MIRT448039	hsa-miR-3175	PAR-CLIP	22100165
MIRT448038	hsa-miR-1343-5p	PAR-CLIP	22100165
MIRT448037	hsa-miR-939-5p	PAR-CLIP	22100165
MIRT448035	hsa-miR-6825-5p	PAR-CLIP	22100165
MIRT448036	hsa-miR-3150a-3p	PAR-CLIP	22100165
MIRT448034	hsa-miR-6763-5p	PAR-CLIP	22100165
MIRT737507	hsa-miR-27a-3p	Luciferase reporter assay, qRT-PCR, Western blot	28099945
MIRT737507	hsa-miR-27a-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	28401000
MIRT737507	hsa-miR-27a-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	28401000
MIRT438354	hsa-miR-206	Luciferase reporter assay, qRT-PCR	27043663
MIRT438354	hsa-miR-206	Luciferase reporter assay, qRT-PCR	27043663
MIRT438354	hsa-miR-206	Luciferase reporter assay, qRT-PCR	27043663
MIRT438354	hsa-miR-206	Luciferase reporter assay, qRT-PCR	27043663
MIRT438354	hsa-miR-206	Luciferase reporter assay, qRT-PCR	27043663
MIRT438354	hsa-miR-206	Luciferase reporter assay, qRT-PCR	27043663
MIRT438354	hsa-miR-206	Luciferase reporter assay, qRT-PCR	27043663
MIRT438354	hsa-miR-206	Luciferase reporter assay, qRT-PCR	27043663
MIRT735991	hsa-miR-196a-3p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR	31609675
MIRT737507	hsa-miR-27a-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), Immunofluorescence, qRT-PCR	32484208
MIRT737564	Sja-miR-1	Luciferase reporter assay, Western blotting, qRT-PCR	32232014
MIRT448052	hsa-miR-504-5p	PAR-CLIP	22100165
MIRT448051	hsa-miR-10a-5p	PAR-CLIP	22100165
MIRT448050	hsa-miR-10b-5p	PAR-CLIP	22100165
MIRT448049	hsa-miR-4292	PAR-CLIP	22100165
MIRT448047	hsa-miR-6791-5p	PAR-CLIP	22100165
MIRT448048	hsa-miR-6852-5p	PAR-CLIP	22100165
MIRT448046	hsa-miR-4667-5p	PAR-CLIP	22100165
MIRT448045	hsa-miR-4700-5p	PAR-CLIP	22100165
MIRT448044	hsa-miR-8089	PAR-CLIP	22100165
MIRT448043	hsa-miR-146a-5p	PAR-CLIP	22100165
MIRT448042	hsa-miR-146b-5p	PAR-CLIP	22100165
MIRT448041	hsa-miR-7153-5p	PAR-CLIP	22100165
MIRT448040	hsa-miR-6878-5p	PAR-CLIP	22100165
MIRT448039	hsa-miR-3175	PAR-CLIP	22100165
MIRT448038	hsa-miR-1343-5p	PAR-CLIP	22100165
MIRT448037	hsa-miR-939-5p	PAR-CLIP	22100165
MIRT448035	hsa-miR-6825-5p	PAR-CLIP	22100165
MIRT448036	hsa-miR-3150a-3p	PAR-CLIP	22100165
MIRT448034	hsa-miR-6763-5p	PAR-CLIP	22100165
MIRT1341890	hsa-miR-103a	CLIP-seq
MIRT1341891	hsa-miR-107	CLIP-seq
MIRT1341892	hsa-miR-1243	CLIP-seq
MIRT1341893	hsa-miR-1252	CLIP-seq
MIRT1341894	hsa-miR-1289	CLIP-seq
MIRT1341895	hsa-miR-1976	CLIP-seq
MIRT1341896	hsa-miR-23a	CLIP-seq
MIRT1341897	hsa-miR-23b	CLIP-seq
MIRT1341898	hsa-miR-23c	CLIP-seq
MIRT1341899	hsa-miR-3125	CLIP-seq
MIRT1341900	hsa-miR-3135	CLIP-seq
MIRT1341901	hsa-miR-3198	CLIP-seq
MIRT1341902	hsa-miR-34b	CLIP-seq
MIRT1341903	hsa-miR-3622a-3p	CLIP-seq
MIRT1341904	hsa-miR-3622b-3p	CLIP-seq
MIRT1341905	hsa-miR-3654	CLIP-seq
MIRT1341906	hsa-miR-3660	CLIP-seq
MIRT1341907	hsa-miR-371-5p	CLIP-seq
MIRT1341908	hsa-miR-3907	CLIP-seq
MIRT1341909	hsa-miR-3916	CLIP-seq
MIRT1341910	hsa-miR-3974	CLIP-seq
MIRT1341911	hsa-miR-4279	CLIP-seq
MIRT1341912	hsa-miR-4294	CLIP-seq
MIRT1341913	hsa-miR-4309	CLIP-seq
MIRT1341914	hsa-miR-4427	CLIP-seq
MIRT1341915	hsa-miR-4438	CLIP-seq
MIRT1341916	hsa-miR-4496	CLIP-seq
MIRT1341917	hsa-miR-4514	CLIP-seq
MIRT1341918	hsa-miR-4526	CLIP-seq
MIRT1341919	hsa-miR-4533	CLIP-seq
MIRT1341920	hsa-miR-4680-3p	CLIP-seq
MIRT1341921	hsa-miR-4681	CLIP-seq
MIRT1341922	hsa-miR-4687-3p	CLIP-seq
MIRT1341923	hsa-miR-4692	CLIP-seq
MIRT1341924	hsa-miR-4704-3p	CLIP-seq
MIRT1341925	hsa-miR-4704-5p	CLIP-seq
MIRT1341926	hsa-miR-4728-3p	CLIP-seq
MIRT1341927	hsa-miR-4742-5p	CLIP-seq
MIRT1341928	hsa-miR-485-3p	CLIP-seq
MIRT1341929	hsa-miR-5095	CLIP-seq
MIRT1341930	hsa-miR-558	CLIP-seq
MIRT1341931	hsa-miR-877	CLIP-seq
MIRT1341932	hsa-miR-940	CLIP-seq
MIRT2101203	hsa-miR-204	CLIP-seq
MIRT2101204	hsa-miR-211	CLIP-seq
MIRT2101205	hsa-miR-3121-5p	CLIP-seq
MIRT2101206	hsa-miR-331-3p	CLIP-seq
MIRT1341902	hsa-miR-34b	CLIP-seq
MIRT1341903	hsa-miR-3622a-3p	CLIP-seq
MIRT1341904	hsa-miR-3622b-3p	CLIP-seq
MIRT2101207	hsa-miR-4281	CLIP-seq
MIRT1341915	hsa-miR-4438	CLIP-seq
MIRT2101208	hsa-miR-4658	CLIP-seq
MIRT1341924	hsa-miR-4704-3p	CLIP-seq
MIRT1341927	hsa-miR-4742-5p	CLIP-seq
MIRT2101209	hsa-miR-4758-5p	CLIP-seq
MIRT2101210	hsa-miR-4765	CLIP-seq
MIRT1341929	hsa-miR-5095	CLIP-seq
MIRT1341930	hsa-miR-558	CLIP-seq
MIRT2325579	hsa-miR-3064-5p	CLIP-seq
MIRT2325580	hsa-miR-3126-5p	CLIP-seq
MIRT2325581	hsa-miR-3136-3p	CLIP-seq
MIRT2325582	hsa-miR-328	CLIP-seq
MIRT2325583	hsa-miR-3613-3p	CLIP-seq
MIRT2325584	hsa-miR-3615	CLIP-seq
MIRT2325585	hsa-miR-3620	CLIP-seq
MIRT2325586	hsa-miR-3919	CLIP-seq
MIRT2325587	hsa-miR-3925-5p	CLIP-seq
MIRT2325588	hsa-miR-3942-3p	CLIP-seq
MIRT1341915	hsa-miR-4438	CLIP-seq
MIRT2325589	hsa-miR-4463	CLIP-seq
MIRT2325590	hsa-miR-4732-3p	CLIP-seq
MIRT2325591	hsa-miR-4756-3p	CLIP-seq
MIRT2325592	hsa-miR-589	CLIP-seq
MIRT2325593	hsa-miR-892b	CLIP-seq
MIRT2394293	hsa-miR-3664-3p	CLIP-seq
MIRT2433053	hsa-miR-128	CLIP-seq
MIRT2433054	hsa-miR-144	CLIP-seq
MIRT2433055	hsa-miR-27a	CLIP-seq
MIRT2433056	hsa-miR-27b	CLIP-seq
MIRT2433057	hsa-miR-3122	CLIP-seq
MIRT2433058	hsa-miR-3140-3p	CLIP-seq
MIRT2433059	hsa-miR-3153	CLIP-seq
MIRT2433060	hsa-miR-330-3p	CLIP-seq
MIRT2433061	hsa-miR-3913-5p	CLIP-seq
MIRT2433062	hsa-miR-4272	CLIP-seq
MIRT2433063	hsa-miR-4464	CLIP-seq
MIRT2433064	hsa-miR-4502	CLIP-seq
MIRT2433065	hsa-miR-4661-3p	CLIP-seq
MIRT2433066	hsa-miR-4668-5p	CLIP-seq
MIRT2433067	hsa-miR-4748	CLIP-seq
MIRT2433068	hsa-miR-4803	CLIP-seq
MIRT2433069	hsa-miR-5096	CLIP-seq
MIRT2433070	hsa-miR-510	CLIP-seq
MIRT2433071	hsa-miR-512-5p	CLIP-seq
MIRT2433072	hsa-miR-513a-5p	CLIP-seq
MIRT2433073	hsa-miR-539	CLIP-seq
MIRT2433074	hsa-miR-651	CLIP-seq
MIRT2433075	hsa-miR-759	CLIP-seq
MIRT2433076	hsa-miR-935	CLIP-seq
MIRT2440199	hsa-miR-1183	CLIP-seq
MIRT2440200	hsa-miR-1236	CLIP-seq
MIRT2440201	hsa-miR-1238	CLIP-seq
MIRT2440202	hsa-miR-127-5p	CLIP-seq
MIRT2440203	hsa-miR-1280	CLIP-seq
MIRT2440204	hsa-miR-1285	CLIP-seq
MIRT2440205	hsa-miR-192	CLIP-seq
MIRT2440206	hsa-miR-193a-5p	CLIP-seq
MIRT2440207	hsa-miR-2115	CLIP-seq
MIRT2440208	hsa-miR-215	CLIP-seq
MIRT1341896	hsa-miR-23a	CLIP-seq
MIRT1341897	hsa-miR-23b	CLIP-seq
MIRT1341898	hsa-miR-23c	CLIP-seq
MIRT2325579	hsa-miR-3064-5p	CLIP-seq
MIRT2440209	hsa-miR-3115	CLIP-seq
MIRT2440210	hsa-miR-3120-3p	CLIP-seq
MIRT2433057	hsa-miR-3122	CLIP-seq
MIRT2433059	hsa-miR-3153	CLIP-seq
MIRT2440211	hsa-miR-3187-5p	CLIP-seq
MIRT2440212	hsa-miR-320a	CLIP-seq
MIRT2440213	hsa-miR-320b	CLIP-seq
MIRT2440214	hsa-miR-320c	CLIP-seq
MIRT2440215	hsa-miR-320d	CLIP-seq
MIRT2440216	hsa-miR-335	CLIP-seq
MIRT2440217	hsa-miR-34c-3p	CLIP-seq
MIRT1341903	hsa-miR-3622a-3p	CLIP-seq
MIRT1341904	hsa-miR-3622b-3p	CLIP-seq
MIRT2440218	hsa-miR-3670	CLIP-seq
MIRT2440219	hsa-miR-3672	CLIP-seq
MIRT2440220	hsa-miR-3685	CLIP-seq
MIRT2440221	hsa-miR-378g	CLIP-seq
MIRT2433061	hsa-miR-3913-5p	CLIP-seq
MIRT2440222	hsa-miR-3977	CLIP-seq
MIRT2440223	hsa-miR-409-3p	CLIP-seq
MIRT2440224	hsa-miR-4251	CLIP-seq
MIRT2440225	hsa-miR-4314	CLIP-seq
MIRT2440226	hsa-miR-4324	CLIP-seq
MIRT2440227	hsa-miR-4325	CLIP-seq
MIRT2440228	hsa-miR-4329	CLIP-seq
MIRT2440229	hsa-miR-4424	CLIP-seq
MIRT2440230	hsa-miR-4429	CLIP-seq
MIRT2325589	hsa-miR-4463	CLIP-seq
MIRT2433063	hsa-miR-4464	CLIP-seq
MIRT2440231	hsa-miR-4486	CLIP-seq
MIRT2433064	hsa-miR-4502	CLIP-seq
MIRT2440232	hsa-miR-4521	CLIP-seq
MIRT2440233	hsa-miR-4536	CLIP-seq
MIRT2433066	hsa-miR-4668-5p	CLIP-seq
MIRT2440234	hsa-miR-4691-5p	CLIP-seq
MIRT2440235	hsa-miR-4693-5p	CLIP-seq
MIRT2433067	hsa-miR-4748	CLIP-seq
MIRT2440236	hsa-miR-4762-3p	CLIP-seq
MIRT2440237	hsa-miR-4778-5p	CLIP-seq
MIRT2440238	hsa-miR-4793-3p	CLIP-seq
MIRT2433070	hsa-miR-510	CLIP-seq
MIRT2433071	hsa-miR-512-5p	CLIP-seq
MIRT2440239	hsa-miR-516a-3p	CLIP-seq
MIRT2433073	hsa-miR-539	CLIP-seq
MIRT2440240	hsa-miR-548aa	CLIP-seq
MIRT2440241	hsa-miR-549	CLIP-seq
MIRT2440242	hsa-miR-580	CLIP-seq
MIRT2440243	hsa-miR-606	CLIP-seq
MIRT2440244	hsa-miR-612	CLIP-seq
MIRT2440245	hsa-miR-630	CLIP-seq
MIRT2440246	hsa-miR-642b	CLIP-seq
MIRT2433075	hsa-miR-759	CLIP-seq
MIRT2325593	hsa-miR-892b	CLIP-seq
MIRT2433076	hsa-miR-935	CLIP-seq
MIRT2459203	hsa-miR-2276	CLIP-seq
MIRT2459204	hsa-miR-4696	CLIP-seq
MIRT2621219	hsa-miR-105	CLIP-seq
MIRT2621220	hsa-miR-10a	CLIP-seq
MIRT2621221	hsa-miR-10b	CLIP-seq
MIRT2440199	hsa-miR-1183	CLIP-seq
MIRT2440200	hsa-miR-1236	CLIP-seq
MIRT2440201	hsa-miR-1238	CLIP-seq
MIRT2440204	hsa-miR-1285	CLIP-seq
MIRT2621222	hsa-miR-1343	CLIP-seq
MIRT2621223	hsa-miR-142-5p	CLIP-seq
MIRT2621224	hsa-miR-1538	CLIP-seq
MIRT2621225	hsa-miR-1913	CLIP-seq
MIRT2440205	hsa-miR-192	CLIP-seq
MIRT2440206	hsa-miR-193a-5p	CLIP-seq
MIRT2621226	hsa-miR-2110	CLIP-seq
MIRT2440208	hsa-miR-215	CLIP-seq
MIRT1341896	hsa-miR-23a	CLIP-seq
MIRT1341897	hsa-miR-23b	CLIP-seq
MIRT1341898	hsa-miR-23c	CLIP-seq
MIRT2440209	hsa-miR-3115	CLIP-seq
MIRT2621227	hsa-miR-3117-5p	CLIP-seq
MIRT2440210	hsa-miR-3120-3p	CLIP-seq
MIRT2433057	hsa-miR-3122	CLIP-seq
MIRT2621228	hsa-miR-3129-3p	CLIP-seq
MIRT2433059	hsa-miR-3153	CLIP-seq
MIRT2440211	hsa-miR-3187-5p	CLIP-seq
MIRT2621229	hsa-miR-3199	CLIP-seq
MIRT2440212	hsa-miR-320a	CLIP-seq
MIRT2440213	hsa-miR-320b	CLIP-seq
MIRT2440214	hsa-miR-320c	CLIP-seq
MIRT2440215	hsa-miR-320d	CLIP-seq
MIRT2621230	hsa-miR-324-3p	CLIP-seq
MIRT2440217	hsa-miR-34c-3p	CLIP-seq
MIRT1341903	hsa-miR-3622a-3p	CLIP-seq
MIRT1341904	hsa-miR-3622b-3p	CLIP-seq
MIRT2440218	hsa-miR-3670	CLIP-seq
MIRT2621231	hsa-miR-3714	CLIP-seq
MIRT2440221	hsa-miR-378g	CLIP-seq
MIRT2621232	hsa-miR-383	CLIP-seq
MIRT2433061	hsa-miR-3913-5p	CLIP-seq
MIRT2621233	hsa-miR-3914	CLIP-seq
MIRT2621234	hsa-miR-3920	CLIP-seq
MIRT2621235	hsa-miR-3921	CLIP-seq
MIRT2621236	hsa-miR-3941	CLIP-seq
MIRT2440223	hsa-miR-409-3p	CLIP-seq
MIRT2621237	hsa-miR-425	CLIP-seq
MIRT2440224	hsa-miR-4251	CLIP-seq
MIRT2621238	hsa-miR-4269	CLIP-seq
MIRT2621239	hsa-miR-431	CLIP-seq
MIRT2440225	hsa-miR-4314	CLIP-seq
MIRT2440227	hsa-miR-4325	CLIP-seq
MIRT2440228	hsa-miR-4329	CLIP-seq
MIRT2440230	hsa-miR-4429	CLIP-seq
MIRT2621240	hsa-miR-4437	CLIP-seq
MIRT1341915	hsa-miR-4438	CLIP-seq
MIRT2621241	hsa-miR-4450	CLIP-seq
MIRT2621242	hsa-miR-4452	CLIP-seq
MIRT2433063	hsa-miR-4464	CLIP-seq
MIRT2440231	hsa-miR-4486	CLIP-seq
MIRT2433064	hsa-miR-4502	CLIP-seq
MIRT2440232	hsa-miR-4521	CLIP-seq
MIRT2621243	hsa-miR-4522	CLIP-seq
MIRT2440233	hsa-miR-4536	CLIP-seq
MIRT2621244	hsa-miR-4633-3p	CLIP-seq
MIRT2621245	hsa-miR-4643	CLIP-seq
MIRT2621246	hsa-miR-4653-5p	CLIP-seq
MIRT2621247	hsa-miR-466	CLIP-seq
MIRT2433066	hsa-miR-4668-5p	CLIP-seq
MIRT2621248	hsa-miR-4672	CLIP-seq
MIRT2440234	hsa-miR-4691-5p	CLIP-seq
MIRT2440235	hsa-miR-4693-5p	CLIP-seq
MIRT2621249	hsa-miR-4714-5p	CLIP-seq
MIRT2621250	hsa-miR-4745-3p	CLIP-seq
MIRT2433067	hsa-miR-4748	CLIP-seq
MIRT2621251	hsa-miR-4749-3p	CLIP-seq
MIRT2621252	hsa-miR-4761-5p	CLIP-seq
MIRT2440237	hsa-miR-4778-5p	CLIP-seq
MIRT2621253	hsa-miR-4789-3p	CLIP-seq
MIRT2440238	hsa-miR-4793-3p	CLIP-seq
MIRT2433070	hsa-miR-510	CLIP-seq
MIRT2433071	hsa-miR-512-5p	CLIP-seq
MIRT2433073	hsa-miR-539	CLIP-seq
MIRT2621254	hsa-miR-548a-5p	CLIP-seq
MIRT2440240	hsa-miR-548aa	CLIP-seq
MIRT2621255	hsa-miR-548ab	CLIP-seq
MIRT2621256	hsa-miR-548ak	CLIP-seq
MIRT2621257	hsa-miR-548an	CLIP-seq
MIRT2621258	hsa-miR-548b-5p	CLIP-seq
MIRT2621259	hsa-miR-548c-5p	CLIP-seq
MIRT2621260	hsa-miR-548d-5p	CLIP-seq
MIRT2621261	hsa-miR-548h	CLIP-seq
MIRT2621262	hsa-miR-548i	CLIP-seq
MIRT2621263	hsa-miR-548j	CLIP-seq
MIRT2621264	hsa-miR-548k	CLIP-seq
MIRT2621265	hsa-miR-548l	CLIP-seq
MIRT2621266	hsa-miR-548w	CLIP-seq
MIRT2621267	hsa-miR-548y	CLIP-seq
MIRT2621268	hsa-miR-559	CLIP-seq
MIRT2621269	hsa-miR-595	CLIP-seq
MIRT2440243	hsa-miR-606	CLIP-seq
MIRT2440244	hsa-miR-612	CLIP-seq
MIRT2621270	hsa-miR-627	CLIP-seq
MIRT2440245	hsa-miR-630	CLIP-seq
MIRT2621271	hsa-miR-635	CLIP-seq
MIRT2440246	hsa-miR-642b	CLIP-seq
MIRT2433075	hsa-miR-759	CLIP-seq
MIRT2621272	hsa-miR-924	CLIP-seq
MIRT2433076	hsa-miR-935	CLIP-seq
MIRT1341932	hsa-miR-940	CLIP-seq
MIRT2621219	hsa-miR-105	CLIP-seq
MIRT2440199	hsa-miR-1183	CLIP-seq
MIRT2440200	hsa-miR-1236	CLIP-seq
MIRT2440201	hsa-miR-1238	CLIP-seq
MIRT2440202	hsa-miR-127-5p	CLIP-seq
MIRT2440204	hsa-miR-1285	CLIP-seq
MIRT2690553	hsa-miR-1303	CLIP-seq
MIRT2621222	hsa-miR-1343	CLIP-seq
MIRT2621223	hsa-miR-142-5p	CLIP-seq
MIRT2621225	hsa-miR-1913	CLIP-seq
MIRT2440205	hsa-miR-192	CLIP-seq
MIRT2440206	hsa-miR-193a-5p	CLIP-seq
MIRT2621226	hsa-miR-2110	CLIP-seq
MIRT2440207	hsa-miR-2115	CLIP-seq
MIRT2440208	hsa-miR-215	CLIP-seq
MIRT1341896	hsa-miR-23a	CLIP-seq
MIRT1341897	hsa-miR-23b	CLIP-seq
MIRT1341898	hsa-miR-23c	CLIP-seq
MIRT2440209	hsa-miR-3115	CLIP-seq
MIRT2621227	hsa-miR-3117-5p	CLIP-seq
MIRT2440210	hsa-miR-3120-3p	CLIP-seq
MIRT2433057	hsa-miR-3122	CLIP-seq
MIRT2621228	hsa-miR-3129-3p	CLIP-seq
MIRT2433059	hsa-miR-3153	CLIP-seq
MIRT2440211	hsa-miR-3187-5p	CLIP-seq
MIRT2621229	hsa-miR-3199	CLIP-seq
MIRT2440212	hsa-miR-320a	CLIP-seq
MIRT2440213	hsa-miR-320b	CLIP-seq
MIRT2440214	hsa-miR-320c	CLIP-seq
MIRT2440215	hsa-miR-320d	CLIP-seq
MIRT2621230	hsa-miR-324-3p	CLIP-seq
MIRT2440217	hsa-miR-34c-3p	CLIP-seq
MIRT1341903	hsa-miR-3622a-3p	CLIP-seq
MIRT1341904	hsa-miR-3622b-3p	CLIP-seq
MIRT2440218	hsa-miR-3670	CLIP-seq
MIRT2440220	hsa-miR-3685	CLIP-seq
MIRT2621231	hsa-miR-3714	CLIP-seq
MIRT2440221	hsa-miR-378g	CLIP-seq
MIRT2621232	hsa-miR-383	CLIP-seq
MIRT2433061	hsa-miR-3913-5p	CLIP-seq
MIRT2621233	hsa-miR-3914	CLIP-seq
MIRT2621235	hsa-miR-3921	CLIP-seq
MIRT2621236	hsa-miR-3941	CLIP-seq
MIRT2440222	hsa-miR-3977	CLIP-seq
MIRT2440223	hsa-miR-409-3p	CLIP-seq
MIRT2621237	hsa-miR-425	CLIP-seq
MIRT2440224	hsa-miR-4251	CLIP-seq
MIRT2621238	hsa-miR-4269	CLIP-seq
MIRT2621239	hsa-miR-431	CLIP-seq
MIRT2440225	hsa-miR-4314	CLIP-seq
MIRT2440226	hsa-miR-4324	CLIP-seq
MIRT2440227	hsa-miR-4325	CLIP-seq
MIRT2440228	hsa-miR-4329	CLIP-seq
MIRT2440230	hsa-miR-4429	CLIP-seq
MIRT2621240	hsa-miR-4437	CLIP-seq
MIRT1341915	hsa-miR-4438	CLIP-seq
MIRT2621241	hsa-miR-4450	CLIP-seq
MIRT2433063	hsa-miR-4464	CLIP-seq
MIRT2440231	hsa-miR-4486	CLIP-seq
MIRT2433064	hsa-miR-4502	CLIP-seq
MIRT2440232	hsa-miR-4521	CLIP-seq
MIRT2621243	hsa-miR-4522	CLIP-seq
MIRT2440233	hsa-miR-4536	CLIP-seq
MIRT2621244	hsa-miR-4633-3p	CLIP-seq
MIRT2621245	hsa-miR-4643	CLIP-seq
MIRT2621246	hsa-miR-4653-5p	CLIP-seq
MIRT2621247	hsa-miR-466	CLIP-seq
MIRT2433066	hsa-miR-4668-5p	CLIP-seq
MIRT2621248	hsa-miR-4672	CLIP-seq
MIRT2440234	hsa-miR-4691-5p	CLIP-seq
MIRT2440235	hsa-miR-4693-5p	CLIP-seq
MIRT2621249	hsa-miR-4714-5p	CLIP-seq
MIRT2433067	hsa-miR-4748	CLIP-seq
MIRT2621251	hsa-miR-4749-3p	CLIP-seq
MIRT2621252	hsa-miR-4761-5p	CLIP-seq
MIRT2440236	hsa-miR-4762-3p	CLIP-seq
MIRT2440237	hsa-miR-4778-5p	CLIP-seq
MIRT2621253	hsa-miR-4789-3p	CLIP-seq
MIRT2440238	hsa-miR-4793-3p	CLIP-seq
MIRT2433070	hsa-miR-510	CLIP-seq
MIRT2433071	hsa-miR-512-5p	CLIP-seq
MIRT2440239	hsa-miR-516a-3p	CLIP-seq
MIRT2433073	hsa-miR-539	CLIP-seq
MIRT2621254	hsa-miR-548a-5p	CLIP-seq
MIRT2440240	hsa-miR-548aa	CLIP-seq
MIRT2621255	hsa-miR-548ab	CLIP-seq
MIRT2621256	hsa-miR-548ak	CLIP-seq
MIRT2621257	hsa-miR-548an	CLIP-seq
MIRT2621258	hsa-miR-548b-5p	CLIP-seq
MIRT2621259	hsa-miR-548c-5p	CLIP-seq
MIRT2621260	hsa-miR-548d-5p	CLIP-seq
MIRT2621261	hsa-miR-548h	CLIP-seq
MIRT2621262	hsa-miR-548i	CLIP-seq
MIRT2621263	hsa-miR-548j	CLIP-seq
MIRT2621264	hsa-miR-548k	CLIP-seq
MIRT2621265	hsa-miR-548l	CLIP-seq
MIRT2621266	hsa-miR-548w	CLIP-seq
MIRT2621267	hsa-miR-548y	CLIP-seq
MIRT2621268	hsa-miR-559	CLIP-seq
MIRT2440242	hsa-miR-580	CLIP-seq
MIRT2440243	hsa-miR-606	CLIP-seq
MIRT2440244	hsa-miR-612	CLIP-seq
MIRT2440245	hsa-miR-630	CLIP-seq
MIRT2621271	hsa-miR-635	CLIP-seq
MIRT2440246	hsa-miR-642b	CLIP-seq
MIRT2433075	hsa-miR-759	CLIP-seq
MIRT2433076	hsa-miR-935	CLIP-seq
MIRT1341932	hsa-miR-940	CLIP-seq

Transcription factors

Show/Hide all(6)

Transcription factor	Regulation	Reference
DNMT1	Unknown	23770846;24374650
DNMT3A	Unknown	24374650
EZH2	Unknown	21515604
GLI1	Activation	19930158
HDAC1	Unknown	23770846
MYC	Repression	20697356

Show/Hide all(131)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001649	Process	Osteoblast differentiation	IEP	16149051
GO:0001657	Process	Ureteric bud development	IEA
GO:0001756	Process	Somitogenesis	IEA
GO:0001843	Process	Neural tube closure	IEA
GO:0001954	Process	Positive regulation of cell-matrix adhesion	ISS
GO:0002244	Process	Hematopoietic progenitor cell differentiation	IDA	19778523
GO:0003002	Process	Regionalization	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	IMP	14581477
GO:0005109	Function	Frizzled binding	IPI	1927703, 10347172, 19277043
GO:0005515	Function	Protein binding	IPI	10347172, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	20551380
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	9192640, 10980594, 17500071
GO:0005829	Component	Cytosol	IDA	14581477
GO:0005886	Component	Plasma membrane	ISS
GO:0008201	Function	Heparin binding	IDA	9192640, 10660608, 11741940
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	10980594
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	10347172, 17443492, 19277043, 20208569
GO:0008584	Process	Male gonad development	IEA
GO:0008585	Process	Female gonad development	IEA
GO:0009267	Process	Cellular response to starvation	IEP	9724099, 11932307
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009950	Process	Dorsal/ventral axis specification	IDA	9192640
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0009986	Component	Cell surface	IDA	9192640
GO:0010564	Process	Regulation of cell cycle process	IMP	9724099
GO:0010629	Process	Negative regulation of gene expression	IDA	10980594
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IDA	19095296
GO:0010975	Process	Regulation of neuron projection development	IEA
GO:0014034	Process	Neural crest cell fate commitment	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016055	Process	Wnt signaling pathway	ISS
GO:0017147	Function	Wnt-protein binding	IBA
GO:0017147	Function	Wnt-protein binding	IDA	17462603
GO:0017147	Function	Wnt-protein binding	IPI	10347172, 10660608, 17462603, 19072540, 24080158
GO:0017147	Function	Wnt-protein binding	NAS	24431302
GO:0021915	Process	Neural tube development	IEA
GO:0030097	Process	Hemopoiesis	IEA
GO:0030097	Process	Hemopoiesis	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030177	Process	Positive regulation of Wnt signaling pathway	IDA	10660608
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IDA	10660608, 17500071, 20208569
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IGI	9192640
GO:0030178	Process	Negative regulation of Wnt signaling pathway	NAS	24431302
GO:0030279	Process	Negative regulation of ossification	IDA	15677765
GO:0030279	Process	Negative regulation of ossification	IEA
GO:0030279	Process	Negative regulation of ossification	IEA
GO:0030279	Process	Negative regulation of ossification	IMP	19254787
GO:0030307	Process	Positive regulation of cell growth	IDA	10980594
GO:0030308	Process	Negative regulation of cell growth	IDA	19569235, 20208569
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0030336	Process	Negative regulation of cell migration	IDA	10980594
GO:0030509	Process	BMP signaling pathway	IEA
GO:0030514	Process	Negative regulation of BMP signaling pathway	IEA
GO:0031012	Component	Extracellular matrix	HDA	20551380
GO:0031012	Component	Extracellular matrix	HDA	27559042
GO:0031012	Component	Extracellular matrix	IDA	9192640, 10347172
GO:0033689	Process	Negative regulation of osteoblast proliferation	IEA
GO:0033689	Process	Negative regulation of osteoblast proliferation	IEA
GO:0033689	Process	Negative regulation of osteoblast proliferation	IMP	19072540
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0035567	Process	Non-canonical Wnt signaling pathway	IBA
GO:0042802	Function	Identical protein binding	IPI	10347172
GO:0043065	Process	Positive regulation of apoptotic process	IDA	9391078, 15677765
GO:0043065	Process	Positive regulation of apoptotic process	IMP	9724099, 16149051, 19254787
GO:0043066	Process	Negative regulation of apoptotic process	IMP	11932307, 14581477, 16149051, 19723665
GO:0045578	Process	Negative regulation of B cell differentiation	IEA
GO:0045578	Process	Negative regulation of B cell differentiation	IMP	18941195
GO:0045600	Process	Positive regulation of fat cell differentiation	IDA	12055200
GO:0045600	Process	Positive regulation of fat cell differentiation	IDA	15886250
GO:0045668	Process	Negative regulation of osteoblast differentiation	IEA
GO:0045671	Process	Negative regulation of osteoclast differentiation	IEA
GO:0045765	Process	Regulation of angiogenesis	ISS
GO:0045880	Process	Positive regulation of smoothened signaling pathway	IMP	17035233
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	10660608, 19095296, 19277043, 20234818
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	16532032
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	10660608, 15886250, 19569235
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	19723665
GO:0046546	Process	Development of primary male sexual characteristics	IEA
GO:0046851	Process	Negative regulation of bone remodeling	IMP	19072540
GO:0048147	Process	Negative regulation of fibroblast proliferation	IDA	19734317
GO:0048546	Process	Digestive tract morphogenesis	IEA
GO:0048863	Process	Stem cell differentiation	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IDA	19095296
GO:0050732	Process	Negative regulation of peptidyl-tyrosine phosphorylation	IDA	10980594
GO:0051496	Process	Positive regulation of stress fiber assembly	ISS
GO:0051894	Process	Positive regulation of focal adhesion assembly	ISS
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	18787224
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	IEA
GO:0060218	Process	Hematopoietic stem cell differentiation	IDA	19778523
GO:0060346	Process	Bone trabecula formation	IEA
GO:0060527	Process	Prostate epithelial cord arborization involved in prostate glandular acinus morphogenesis	IEA
GO:0060687	Process	Regulation of branching involved in prostate gland morphogenesis	IEA
GO:0060766	Process	Negative regulation of androgen receptor signaling pathway	IDA	19277043
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0071305	Process	Cellular response to vitamin D	IEP	16149051
GO:0071347	Process	Cellular response to interleukin-1	IEP	16149051
GO:0071356	Process	Cellular response to tumor necrosis factor	IDA	9391078
GO:0071380	Process	Cellular response to prostaglandin E stimulus	IEP	16149051
GO:0071391	Process	Cellular response to estrogen stimulus	IDA	18941195
GO:0071391	Process	Cellular response to estrogen stimulus	IEA
GO:0071392	Process	Cellular response to estradiol stimulus	IEP	11932307
GO:0071456	Process	Cellular response to hypoxia	IEP	11932307
GO:0071481	Process	Cellular response to X-ray	IEA
GO:0071542	Process	Dopaminergic neuron differentiation	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEP	16149051
GO:0071773	Process	Cellular response to BMP stimulus	IEP	16149051
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IDA	9391078, 10347172, 16149051, 17443492, 17471511, 17994217, 19095296, 19277043, 19569235
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IGI	17462603, 24080158
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IMP	9724099, 16532032, 17035233, 19072540, 19254787
GO:0090175	Process	Regulation of establishment of planar polarity	IEA
GO:0090244	Process	Wnt signaling pathway involved in somitogenesis	IEA
GO:0090246	Process	Convergent extension involved in somitogenesis	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IDA	18941195
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IGI	24080158
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IEA
GO:1902043	Process	Positive regulation of extrinsic apoptotic signaling pathway via death domain receptors	IDA	9391078
GO:1904956	Process	Regulation of midbrain dopaminergic neuron differentiation	IEA
GO:2000052	Process	Positive regulation of non-canonical Wnt signaling pathway	IDA	19569235
GO:2000270	Process	Negative regulation of fibroblast apoptotic process	IDA	14581477
GO:2000271	Process	Positive regulation of fibroblast apoptotic process	IDA	14581477
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IEA
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IEA

MIM	HGNC	e!Ensembl
604156	10776	ENSG00000104332

Protein

UniProt ID

Q8N474

Protein name

Secreted frizzled-related protein 1 (FRP-1) (sFRP-1) (Secreted apoptosis-related protein 2) (SARP-2)

Protein function

Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP1 decreases intracellular beta-cat

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01392	Fz	58 → 165	Fz domain	Domain
PF01759	NTR	200 → 296	UNC-6/NTR/C345C module	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Absent from lung, liver and peripheral blood leukocytes. Highest levels in heart and fetal kidney. Also expressed in testis, ovary, fetal brain and lung, leiomyomal cells, myometrial cells and vascular smooth muscle c

Sequence

MGIGRSEGGRRGAALGVLLALGAALLAVGSASEYDYVSFQSDIGPYQSGRFYTKPPQCVD
IPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPV
CLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKP
QGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKK
KDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKK
MKNHECPTFQSVFK

Sequence length

314

Interactions

View interactions

	KEGG
	Wnt signaling pathway

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Type 2 diabetes	N/A	N/A	GWAS

Show/Hide Text Mining Associations (115)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acro Osteolysis	Associate	23334979
Adenocarcinoma	Associate	18831746, 19513747, 26482433, 32764696
Adenocarcinoma in Situ	Associate	21731750
Adenocarcinoma of Lung	Associate	21731750
Adenoma	Inhibit	16523202, 17131472
Adenoma	Associate	21154739, 22248913, 25432628, 25915531, 27896617, 28058013, 28753106, 30578081
Adenomatous Polyposis Coli	Associate	20628379, 28708837
Aphasia	Associate	27251476
Arthritis Rheumatoid	Associate	12428226, 21515604
Asthma	Associate	25147914
Astrocytoma	Associate	24305703, 30394013
Biliary Tract Neoplasms	Associate	24594839
Brain Neoplasms	Associate	32783304
Breast Neoplasms	Inhibit	16410723, 19569235, 28099945, 33550915
Breast Neoplasms	Associate	17897439, 18283316, 18990230, 19110721, 20716965, 22026417, 22037257, 22701537, 22826467, 22986510, 23011155, 25036590, 28984209, 30651373, 31638237 View all (5 more)
Cancer Familial with In Vitro Radioresistance	Associate	32046444
Carcinogenesis	Associate	21709441, 24949429, 27739564, 31128064, 32236623, 36368958
Carcinoma Ductal	Associate	35343265
Carcinoma Ductal Breast	Associate	35343265
Carcinoma Endometrioid	Associate	21709441, 26397159
Carcinoma Hepatocellular	Associate	16795071, 18577996, 20079733, 21046672, 22180715, 22351518, 27545991, 32189106, 32293507, 32311840, 34268946, 38062093
Carcinoma Hepatocellular	Inhibit	17626620
Carcinoma Intraductal Noninfiltrating	Inhibit	16410723
Carcinoma Intraductal Noninfiltrating	Associate	32050925
Carcinoma Lobular	Associate	27078887
Carcinoma Non Small Cell Lung	Associate	27534621, 28422739, 37505453, 37999144
Carcinoma Pancreatic Ductal	Associate	18820670, 37230892, 37533202
Carcinoma Renal Cell	Associate	20154727, 22419128, 22826467, 23572277, 24454902, 34222474
Carcinoma Squamous Cell	Associate	26394929
Carcinoma Squamous Cell	Inhibit	27420949
Cholangiocarcinoma	Associate	22983262, 24948044, 36368958
Colitis Ulcerative	Associate	18716850
Colorectal Neoplasms	Associate	15471560, 15526363, 17131472, 18212756, 19404924, 21304055, 22703586, 23975090, 24948044, 25405986, 25991403, 26291085, 26482433, 27245242, 28058013 View all (9 more)
Colorectal Neoplasms	Inhibit	16523202, 24949429
Developmental Disabilities	Associate	27251476
Disease Resistance	Associate	29371858
Dysplastic Nevus Syndrome	Inhibit	16523202
Eosinophilic Esophagitis	Stimulate	37652141
Esophageal Squamous Cell Carcinoma	Stimulate	22171134
Glaucoma	Associate	23258147
Glioblastoma	Associate	30394013
Glioma	Associate	24305703, 26337424, 26712519
Glucocorticoid Receptor Deficiency	Inhibit	20555348
Graves Ophthalmopathy	Associate	15886250
Hepatitis C	Associate	24386373
Hepatitis C Chronic	Associate	36003399
Hepatoblastoma	Associate	29507645
Hepatoblastoma	Inhibit	32189106
Hereditary leiomyomatosis and renal cell cancer	Inhibit	36455002
Hyperostosis Diffuse Idiopathic Skeletal	Stimulate	28153008
Hypoxia	Associate	30065361
Idiopathic Noncirrhotic Portal Hypertension	Associate	16795071
Inflammation	Associate	24386373, 28402277
Inflammatory Bowel Diseases	Associate	18716850
Keloid	Inhibit	20555348
Keratoconus	Associate	23825088, 29860458
Kidney Neoplasms	Associate	22419128, 23591200
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	19543515, 28468589
Leukemia Myeloid Acute	Associate	19543515, 20795789, 22031861, 24164743
Leukemia Promyelocytic Acute	Associate	22031861
Liver Neoplasms	Associate	32189106
Lung Neoplasms	Associate	29270240
Lymphatic Metastasis	Associate	24594839, 31128064
Medulloblastoma	Associate	20823417
Melanoma	Associate	21606880
Meningioma	Associate	20685720
Metabolic Syndrome	Associate	31366177
Multiple Sclerosis	Stimulate	32046444
Muscular Dystrophy Duchenne	Associate	18021006
Myocardial Infarction	Associate	27391264, 37203392
Myocardial Infarction	Stimulate	31504423
Myopia	Associate	23468642
Neoplasm Metastasis	Associate	17465504, 21731750, 30065361, 30902884
Neoplasms	Inhibit	15471560, 16410723, 16523202, 17131472, 17626620, 19513747, 20716965, 21599969, 22139572, 22701537, 25036590, 25732201, 39300373
Neoplasms	Associate	15526363, 15542433, 15899813, 16775427, 16795071, 17465504, 17968429, 18831746, 19569235, 20098741, 20154727, 20420713, 21046672, 21304055, 21606880 View all (31 more)
Neoplasms	Stimulate	25432628, 37999144
Neuroblastoma	Associate	20830616
Neuroendocrine Tumors	Stimulate	25058880
Obesity	Associate	32749195
Osteolysis	Associate	25399506
Osteosarcoma	Inhibit	31072914
Osteosarcoma	Associate	34305100
Ovarian Neoplasms	Associate	15471560, 36259450, 37417299
Pancreatic Intraductal Neoplasms	Stimulate	16670620
Pancreatic Intraductal Neoplasms	Associate	18157091, 18820670
Pancreatic Neoplasms	Associate	16670620, 27891190, 37547756
Parathyroid Neoplasms	Associate	21638518
Peritoneal Neoplasms	Stimulate	32764696
Personality Disorders	Associate	35343265
Polycystic Ovary Syndrome	Associate	33228780
Polyposis Syndrome Hereditary Mixed 1	Associate	28753106
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	18537968, 22095226
Prostatic Neoplasms	Associate	15899813, 19277043, 24504368, 25719802, 30177832
Prostatitis	Inhibit	16847812
Retinal Dysplasia	Associate	21154739
Retinal Dystrophies	Associate	15235574
Scotoma	Associate	27251476
Seizures	Associate	40591616
Sick Sinus Syndrome	Stimulate	22986510
Smoke Inhalation Injury	Associate	32564237
Soft Tissue Injuries	Associate	25639201
Spherocytosis Type 1	Associate	37922232
Squamous Cell Carcinoma of Head and Neck	Associate	24359512, 29790687, 29900911, 35892344, 39300373
Stomach Neoplasms	Associate	17465504, 23049225, 23943784, 27739564, 30902884
Stomach Neoplasms	Inhibit	30593147
Trigeminal Neuralgia	Associate	38158702
Triple Negative Breast Neoplasms	Associate	22826467, 35507080
Triple Negative Breast Neoplasms	Stimulate	25033833
Tuberculosis Pulmonary	Associate	36569862
Turcot syndrome	Associate	30578081
Urethral Neoplasms	Associate	16775427
Urinary Bladder Neoplasms	Inhibit	14968126, 28268231
Urinary Bladder Neoplasms	Associate	19565266, 21599969, 24133576, 25732201
Uterine Cervical Neoplasms	Associate	19513747
Vitiligo	Associate	27193292

SFRP1 (secreted frizzled related protein 1)