Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	64216
Gene name Gene Name - the full gene name approved by the HGNC.	Transcription factor B2, mitochondrial
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TFB2M
Synonyms (NCBI Gene) Gene synonyms aliases	Hkp1, h-mtTFB, h-mtTFB2, hTFB2M, mtTFB2
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q44

Show/Hide all(49)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022454	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT029159	hsa-miR-26b-5p	Microarray	19088304
MIRT1420013	hsa-miR-1208	CLIP-seq
MIRT1420014	hsa-miR-3166	CLIP-seq
MIRT1420015	hsa-miR-452	CLIP-seq
MIRT1420016	hsa-miR-4676-3p	CLIP-seq
MIRT2126152	hsa-miR-1254	CLIP-seq
MIRT2126153	hsa-miR-19a	CLIP-seq
MIRT2126154	hsa-miR-19b	CLIP-seq
MIRT2126155	hsa-miR-3116	CLIP-seq
MIRT2126156	hsa-miR-661	CLIP-seq
MIRT2348119	hsa-miR-1237	CLIP-seq
MIRT2126152	hsa-miR-1254	CLIP-seq
MIRT2348120	hsa-miR-1265	CLIP-seq
MIRT2126153	hsa-miR-19a	CLIP-seq
MIRT2126154	hsa-miR-19b	CLIP-seq
MIRT2126155	hsa-miR-3116	CLIP-seq
MIRT2348121	hsa-miR-3616-5p	CLIP-seq
MIRT2348122	hsa-miR-3647-5p	CLIP-seq
MIRT2348123	hsa-miR-4670-3p	CLIP-seq
MIRT2348124	hsa-miR-4696	CLIP-seq
MIRT2348125	hsa-miR-4724-3p	CLIP-seq
MIRT2348126	hsa-miR-4762-5p	CLIP-seq
MIRT2348127	hsa-miR-4764-5p	CLIP-seq
MIRT2348128	hsa-miR-4766-5p	CLIP-seq
MIRT2348129	hsa-miR-4773	CLIP-seq
MIRT2348130	hsa-miR-488	CLIP-seq
MIRT2348131	hsa-miR-573	CLIP-seq
MIRT2348132	hsa-miR-579	CLIP-seq
MIRT2126156	hsa-miR-661	CLIP-seq
MIRT2640819	hsa-miR-101	CLIP-seq
MIRT2348121	hsa-miR-3616-5p	CLIP-seq
MIRT2348122	hsa-miR-3647-5p	CLIP-seq
MIRT2348123	hsa-miR-4670-3p	CLIP-seq
MIRT2640820	hsa-miR-4709-5p	CLIP-seq
MIRT2348126	hsa-miR-4762-5p	CLIP-seq
MIRT2640821	hsa-miR-494	CLIP-seq
MIRT2640822	hsa-miR-545	CLIP-seq
MIRT2640823	hsa-miR-548ad	CLIP-seq
MIRT2640824	hsa-miR-548c-3p	CLIP-seq
MIRT2348131	hsa-miR-573	CLIP-seq
MIRT2348132	hsa-miR-579	CLIP-seq
MIRT2348121	hsa-miR-3616-5p	CLIP-seq
MIRT2348122	hsa-miR-3647-5p	CLIP-seq
MIRT2348123	hsa-miR-4670-3p	CLIP-seq
MIRT2348126	hsa-miR-4762-5p	CLIP-seq
MIRT2640821	hsa-miR-494	CLIP-seq
MIRT2640823	hsa-miR-548ad	CLIP-seq
MIRT2348131	hsa-miR-573	CLIP-seq

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000154	Process	RRNA modification	IEA
GO:0000179	Function	RRNA (adenine-N6,N6-)-dimethyltransferase activity	IBA
GO:0000179	Function	RRNA (adenine-N6,N6-)-dimethyltransferase activity	IEA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003723	Function	RNA binding	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IBA
GO:0005759	Component	Mitochondrial matrix	IDA	12068295
GO:0005759	Component	Mitochondrial matrix	NAS	29149603
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006364	Process	RRNA processing	IEA
GO:0006390	Process	Mitochondrial transcription	IDA	12068295
GO:0006391	Process	Transcription initiation at mitochondrial promoter	IBA
GO:0006391	Process	Transcription initiation at mitochondrial promoter	IDA	20410300, 29149603
GO:0008168	Function	Methyltransferase activity	IEA
GO:0008988	Function	RRNA (adenine-N6-)-methyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0031167	Process	RRNA methylation	IBA
GO:0032259	Process	Methylation	IEA
GO:0034246	Function	Mitochondrial transcription factor activity	IBA
GO:0034246	Function	Mitochondrial transcription factor activity	IDA	12068295, 29149603
GO:0042645	Component	Mitochondrial nucleoid	IDA	18063578

MIM	HGNC	e!Ensembl
607055	18559	ENSG00000162851

Protein

UniProt ID

Q9H5Q4

Protein name

Dimethyladenosine transferase 2, mitochondrial (EC 2.1.1.-) (Hepatitis C virus NS5A-transactivated protein 5) (HCV NS5A-transactivated protein 5) (Mitochondrial 12S rRNA dimethylase 2) (Mitochondrial transcription factor B2) (h-mtTFB) (h-mtTFB2) (hTFB2M)

Protein function

S-adenosyl-L-methionine-dependent rRNA methyltransferase which may methylate two specific adjacent adenosines in the loop of a conserved hairpin near the 3'-end of 12S mitochondrial rRNA (Probable). Component of the mitochondrial transcription i

PDB

6ERO , 6ERP , 6ERQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00398	RrnaAD	71 → 379	Ribosomal RNA adenine dimethylase	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:12068295}.

Sequence

MWIPVVGLPRRLRLSALAGAGRFCILGSEAATRKHLPARNHCGLSDSSPQLWPEPDFRNP
PRKASKASLDFKRYVTDRRLAETLAQIYLGKPSRPPHLLLECNPGPGILTQALLEAGAKV
VALESDKTFIPHLESLGKNLDGKLRVIHCDFFKLDPRSGGVIKPPAMSSRGLFKNLGIEA
VPWTADIPLKVVGMFPSRGEKRALWKLAYDLYSCTSIYKFGRIEVNMFIGEKEFQKLMAD
PGNPDLYHVLSVIWQLACEIKVLHMEPWSSFDIYTRKGPLENPKRRELLDQLQQKLYLIQ
MIPRQNLFTKNLTPMNYNIFFHLLKHCFGRRSATVIDHLRSLTPLDARDILMQIGKQEDE
KVVNMHPQDFKTLFETIERSKDCAYKWLYDETLEDR

Sequence length

396

Interactions

View interactions

	Reactome
			Mitochondrial transcription initiation Transcriptional activation of mitochondrial biogenesis

TFB2M (transcription factor B2, mitochondrial)