Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	64215
Gene name Gene Name - the full gene name approved by the HGNC.	DnaJ heat shock protein family (Hsp40) member C1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DNAJC1
Synonyms (NCBI Gene) Gene synonyms aliases	DNAJL1, ERdj1, HTJ1, MTJ1
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10p12.31
Summary Summary of gene provided in NCBI Entrez Gene.	The membrane protein encoded by this gene is a DNAJ-like heat shock protein that binds the molecular chaperone BiP. In addition, the encoded protein contains two SANT domains that have been shown to bind serpin alpha1-antichymotrypsin and inter-alpha tryp

Show/Hide all(52)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002721	hsa-miR-124-3p	Microarray	15685193
MIRT002721	hsa-miR-124-3p	Microarray	15685193
MIRT002721	hsa-miR-124-3p	Microarray	18668037
MIRT031667	hsa-miR-16-5p	Proteomics	18668040
MIRT032341	hsa-let-7b-5p	Proteomics	18668040
MIRT940550	hsa-let-7a	CLIP-seq
MIRT940551	hsa-let-7b	CLIP-seq
MIRT940552	hsa-let-7c	CLIP-seq
MIRT940553	hsa-let-7d	CLIP-seq
MIRT940554	hsa-let-7e	CLIP-seq
MIRT940555	hsa-let-7f	CLIP-seq
MIRT940556	hsa-let-7g	CLIP-seq
MIRT940557	hsa-let-7i	CLIP-seq
MIRT940558	hsa-miR-124	CLIP-seq
MIRT940559	hsa-miR-1277	CLIP-seq
MIRT940560	hsa-miR-202	CLIP-seq
MIRT940561	hsa-miR-3148	CLIP-seq
MIRT940562	hsa-miR-3646	CLIP-seq
MIRT940563	hsa-miR-3662	CLIP-seq
MIRT940564	hsa-miR-3714	CLIP-seq
MIRT940565	hsa-miR-3910	CLIP-seq
MIRT940566	hsa-miR-3978	CLIP-seq
MIRT940567	hsa-miR-4458	CLIP-seq
MIRT940568	hsa-miR-4461	CLIP-seq
MIRT940569	hsa-miR-4500	CLIP-seq
MIRT940570	hsa-miR-4662a-3p	CLIP-seq
MIRT940571	hsa-miR-4698	CLIP-seq
MIRT940572	hsa-miR-4757-3p	CLIP-seq
MIRT940573	hsa-miR-4795-3p	CLIP-seq
MIRT940574	hsa-miR-493	CLIP-seq
MIRT940575	hsa-miR-506	CLIP-seq
MIRT940576	hsa-miR-513a-3p	CLIP-seq
MIRT940577	hsa-miR-544	CLIP-seq
MIRT940578	hsa-miR-579	CLIP-seq
MIRT940579	hsa-miR-664	CLIP-seq
MIRT940580	hsa-miR-98	CLIP-seq
MIRT940550	hsa-let-7a	CLIP-seq
MIRT940551	hsa-let-7b	CLIP-seq
MIRT940552	hsa-let-7c	CLIP-seq
MIRT940553	hsa-let-7d	CLIP-seq
MIRT940554	hsa-let-7e	CLIP-seq
MIRT940555	hsa-let-7f	CLIP-seq
MIRT940556	hsa-let-7g	CLIP-seq
MIRT940557	hsa-let-7i	CLIP-seq
MIRT940560	hsa-miR-202	CLIP-seq
MIRT940567	hsa-miR-4458	CLIP-seq
MIRT940568	hsa-miR-4461	CLIP-seq
MIRT940569	hsa-miR-4500	CLIP-seq
MIRT940571	hsa-miR-4698	CLIP-seq
MIRT940576	hsa-miR-513a-3p	CLIP-seq
MIRT940577	hsa-miR-544	CLIP-seq
MIRT940580	hsa-miR-98	CLIP-seq

Show/Hide all(15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001671	Function	ATPase activator activity	TAS	14668352
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	14668352, 16271702, 32296183, 32814053
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006417	Process	Regulation of translation	IEA
GO:0006457	Process	Protein folding	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016021	Component	Integral component of membrane	IEA
GO:0031965	Component	Nuclear membrane	IEA
GO:0032781	Process	Positive regulation of ATPase activity	IEA
GO:0045861	Process	Negative regulation of proteolysis	TAS	14668352
GO:0050708	Process	Regulation of protein secretion	IDA	14668352
GO:0051087	Function	Chaperone binding	IEA

MIM	HGNC	e!Ensembl
611207	20090	ENSG00000136770

Protein

UniProt ID

Q96KC8

Protein name

DnaJ homolog subfamily C member 1 (DnaJ protein homolog MTJ1)

Protein function

May modulate protein synthesis.

PDB

2CQQ , 2CQR

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00226	DnaJ	65 → 126	DnaJ domain	Domain
PF00249	Myb_DNA-binding	494 → 543	Myb-like DNA-binding domain	Domain

Sequence

MTAPCSQPAQLPGRRQLGLVPFPPPPPRTPLLWLLLLLLAAVAPARGWESGDLELFDLVE
EVQLNFYQFLGVQQDASSADIRKAYRKLSLTLHPDKNKDENAETQFRQLVAIYEVLKDDE
RRQRYDDILINGLPDWRQPVFYYRRVRKMSNAELALLLFIILTVGHYAVVWSIYLEKQLD
ELLSRKKREKKKKTGSKSVDVSKLGASEKNERLLMKPQWHDLLPCKLGIWFCLTLKALPH
LIQDAGQFYAKYKETRLKEKEDALTRTELETLQKQKKVKKPKPEFPVYTPLETTYIQSYD
HGTSIEEIEEQMDDWLENRNRTQKKQAPEWTEEDLSQLTRSMVKFPGGTPGRWEKIAHEL
GRSVTDVTTKAKQLKDSVTCSPGMVRLSELKSTVQNSRPIKTATTLPDDMITQREDAEGV
AAEEEQEGDSGEQETGATDARPRRRKPARLLEATAKPEPEEKSRAKRQKDFDIAEQNESS
DEESLRKERARSAEEPWTQNQQKLLELALQQYPRGSSDRWDKIARCVPSKSKEDCIARYK
LLVELVQKKKQAKS

Sequence length

554

Interactions

View interactions

	KEGG
	Protein processing in endoplasmic reticulum

Show/Hide Causal Diseases (4)

Disease term	Disease name	dbSNP ID	References
Causal
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451 View all (71 more)	29059683
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	27903959
Melanoma	melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340 View all (64 more)	22535842
Parkinson disease	Parkinson Disease	rs33939927, rs35801418, rs34805604, rs35870237, rs34995376, rs74315355, rs28940284, rs74315356, rs74315357, rs28940285, rs730880302, rs750664040, rs74315359, rs74315360, rs45539432 View all (84 more)	17052657

Show/Hide Unknown Diseases (4)

Disease term	Disease name	Evidence	Source
Unknown
Breast cancer	Breast cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients	GWAS, CBGDA
Hypertension	Hypertension		GWAS
Glioblastoma	Glioblastoma	CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587	GWAS, CBGDA
Insomnia	Insomnia		GWAS

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Associate	33735170
Inflammation	Associate	26480920
Leukemia Myeloid Acute	Associate	31648321
Melanoma Cutaneous Malignant	Associate	19838160
Neoplasms	Associate	19838160
Obesity	Associate	26480920
Periodontitis	Associate	34732256

DNAJC1 (DnaJ heat shock protein family (Hsp40) member C1)