Gene Gene information from NCBI Gene database.
Entrez ID 64211
Gene name LIM homeobox 5
Gene symbol LHX5
Synonyms (NCBI Gene)
-
Chromosome 12
Chromosome location 12q24.13
Summary This gene encodes a protein belonging to a large protein family, members of which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and be involved in the control of different
miRNA miRNA information provided by mirtarbase database.
52
miRTarBase ID miRNA Experiments Reference
MIRT711617 hsa-miR-216b-5p HITS-CLIP 19536157
MIRT711615 hsa-miR-6892-3p HITS-CLIP 19536157
MIRT711614 hsa-miR-2276-5p HITS-CLIP 19536157
MIRT711613 hsa-miR-3183 HITS-CLIP 19536157
MIRT711612 hsa-miR-4723-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
27
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605992 14216 ENSG00000089116
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H2C1
Protein name LIM/homeobox protein Lhx5 (LIM homeobox protein 5)
Protein function Plays an essential role in the regulation of neuronal differentiation and migration during development of the central nervous system.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00412 LIM 5 60 LIM domain Domain
PF00412 LIM 64 123 LIM domain Domain
PF00046 Homeodomain 181 237 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in fetal brain and in various regions of the adult central nervous system including the spinal cord, the thalamus, and the cerebellum.
Sequence
MMVHCAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKCFSREGKLYCKNDFFRRF
GTKCAGCAQGISPSDLVRKARSKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKDDYL
SSS
SLKEGSLNSVSSCTDRSLSPDLQDALQDDPKETDNSTSSDKETANNENEEQNSGTKR
RGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQ
LSALGARRHAFFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQGDYYAPGSNYDFFAHGP
PSQAQSPADSSFLAASGPGSTPLGALEPPLAGPHAADNPRFTDMISHPDTPSPEPGLPGT
LHPMPGEVFSGGPSPPFPMSGTSGYSGPLSHPNPELNEAAVW
Sequence length 402
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Signaling pathways regulating pluripotency of stem cells