Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6421
Gene name Gene Name - the full gene name approved by the HGNC.
Splicing factor proline and glutamine rich
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SFPQ
Synonyms (NCBI Gene) Gene synonyms aliases
POMP100, PPP1R140, PSF
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p34.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT002310 hsa-miR-29b-3p Immunoprecipitaion, Luciferase reporter assay, Western blot 17637574
MIRT002309 hsa-miR-141-3p Immunoprecipitaion, Luciferase reporter assay, Western blot 17637574
MIRT047727 hsa-miR-10a-5p CLASH 23622248
MIRT043279 hsa-miR-331-3p CLASH 23622248
MIRT043279 hsa-miR-331-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 16731528
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IGI 15790595
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 22783022
GO:0000380 Process Alternative mRNA splicing, via spliceosome IBA
GO:0000380 Process Alternative mRNA splicing, via spliceosome IMP 19874820
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605199 10774 ENSG00000116560
Protein
UniProt ID P23246
Protein name Splicing factor, proline- and glutamine-rich (100 kDa DNA-pairing protein) (hPOMp100) (DNA-binding p52/p100 complex, 100 kDa subunit) (Polypyrimidine tract-binding protein-associated-splicing factor) (PSF) (PTB-associated-splicing factor)
Protein function DNA- and RNA binding protein, involved in several nuclear processes. Essential pre-mRNA splicing factor required early in spliceosome formation and for splicing catalytic step II, probably as a heteromer with NONO. Binds to pre-mRNA in spliceoso
PDB 4WII , 4WIJ , 4WIK , 5WPA , 6NCQ , 6OWJ , 6WMZ , 7LRQ , 7LRU , 7PU5 , 7SP0 , 7UJ1 , 7UK1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 299 363 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 373 440 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF08075 NOPS 444 495 NOPS (NUC059) domain Domain
Sequence
MSRDRFRSRGGGGGGFHRRGGGGGRGGLHDFRSPPPGMGLNQNRGPMGPGPGQSGPKPPI
PPPPPHQQQQQPPPQQPPPQQPPPHQPPPHPQPHQQQQPPPPPQDSSKPVVAQGPGPAPG
VGSAPPASSSAPPATPPTSGAPPGSGPGPTPTPPPAVTSAPPGAPPPTPPSSGVPTTPPQ
AGGPPPPPAAVPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGE
PRGGRQHHPPYHQQHHQGPPPGGPGGRSEEKISDSEGFKANLSLLRRPGEKTYTQRCRLF
VGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRALAEIAKAELDDTPMRGR
QLR
VRFATHAAALSVRNLSPYVSNELLEEAFSQFGPIERAVVIVDDRGRSTGKGIVEFAS
KPAARKAFERCSEGVFLLTT
TPRPVIVEPLEQLDDEDGLPEKLAQKNPMYQKERETPPRF
AQHGTFEYEYSQRWK
SLDEMEKQQREQVEKNMKDAKDKLESEMEDAYHEHQANLLRQDLM
RRQEELRRMEELHNQEMQKRKEMQLRQEEERRRREEEMMIRQREMEEQMRRQREESYSRM
GYMDPRERDMRMGGGGAMNMGDPYGSGGQKFPPLGGGGGIGYEANPGVPPATMSGSMMGS
DMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNKKPRF
Sequence length 707
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    PTK6 Regulates Proteins Involved in RNA Processing
Suppression of apoptosis
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Amyotrophic Lateral Sclerosis Associate 33495278, 33693641, 36168806
Amyotrophic lateral sclerosis 1 Associate 36168806
Breast Neoplasms Associate 33017027
Calcinosis Associate 29713041
Carcinoma Hepatocellular Associate 37324188
Carcinoma Non Small Cell Lung Stimulate 37569873
Carcinoma Non Small Cell Lung Associate 37960731
Carcinoma Renal Cell Associate 26975036, 30951404
Colorectal Neoplasms Associate 24288667, 38166604
Cystic Disease Of Lung Associate 34404863