Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
64145
Gene name Gene Name - the full gene name approved by the HGNC.
Rabenosyn, RAB effector
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RBSN
Synonyms (NCBI Gene) Gene synonyms aliases
KAREVS, MFANDO, Rabenosyn-5, ZFYVE20
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p25.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that belongs to the FYVE zinc finger family of proteins. The encoded protein interacts with Ras-related proteins that regulate membrane trafficking. A missense mutation in this gene is associated with a defect in the early endo
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT439233 hsa-miR-374a-5p HITS-CLIP 22473208
MIRT439233 hsa-miR-374a-5p HITS-CLIP 22473208
MIRT741217 hsa-miR-1321 PAR-CLIP 27292025
MIRT741224 hsa-miR-3160-3p PAR-CLIP 27292025
MIRT741231 hsa-miR-3689d PAR-CLIP 27292025
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 15020713, 16034420, 25416956, 28514442, 29997244, 32296183, 33961781, 35271311
GO:0005768 Component Endosome IEA
GO:0005768 Component Endosome NAS 11062261
GO:0005769 Component Early endosome IDA 35652444
GO:0005829 Component Cytosol IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609511 20759 ENSG00000131381
Protein
UniProt ID Q9H1K0
Protein name Rabenosyn-5 (110 kDa protein) (FYVE finger-containing Rab5 effector protein rabenosyn-5) (RAB effector RBSN) (Zinc finger FYVE domain-containing protein 20)
Protein function Rab4/Rab5 effector protein acting in early endocytic membrane fusion and membrane trafficking of recycling endosomes. Required for endosome fusion either homotypically or with clathrin coated vesicles. Plays a role in the lysosomal trafficking o
PDB 1YZM , 1Z0J , 1Z0K
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01363 FYVE 152 261 FYVE zinc finger Domain
PF11464 Rbsn 458 499 Rabenosyn Rab binding domain Domain
PF16601 NPF 548 737 Disordered
PF11464 Rbsn 738 779 Rabenosyn Rab binding domain Domain
Sequence
MASLDDPGEVREGFLCPLCLKDLQSFYQLHSHYEEEHSGEDRDVKGQIKSLVQKAKKAKD
RLLKREGDDRAESGTQGYESFSYGGVDPYMWEPQELGAVRSHLSDFKKHRAARIDHYVVE
VNKLIIRLEKLTAFDRTNTESAKIRAIEKSVVPWVNDQDVPFCPDCGNKFSIRNRRHHCR
LCGSIMCKKCMELISLPLANKLTSASKESLSTHTSPSQSPNSVHGSRRGSISSMSSVSSV
LDEKDDDRIRCCTHCKDTLLK
REQQIDEKEHTPDIVKLYEKLRLCMEKVDQKAPEYIRMA
ASLNAGETTYSLEHASDLRVEVQKVYELIDALSKKILTLGLNQDPPPHPSNLRLQRMIRY
SATLFVQEKLLGLMSLPTKEQFEELKKKRKEEMERKRAVERQAALESQRRLEERQSGLAS
RAANGEVASLRRGPAPLRKAEGWLPLSGGQGQSEDSDPLLQQIHNITSFIRQAKAAGRMD
EVRTLQENLRQLQDEYDQQ
QTEKAIELSRRQAEEEDLQREQLQMLRERELEREREQFRVA
SLHTRTRSLDFREIGPFQLEPSREPRTHLAYALDLGSSPVPSSTAPKTPSLSSTQPTRVW
SGPPAVGQERLPQSSMPQQHEGPSLNPFDEEDLSSPMEEATTGPPAAGVSLDPSARILKE
YNPFEEEDEEEEAVAGNPFIQPDSPAPNPFSEEDEHPQQRLSSPLVPGNPFEEPTCINPF
EMDSDSGPEAEEPIEEE
LLLQQIDNIKAYIFDAKQCGRLDEVEVLTENLRELKHTLAKQK
GGTD
Sequence length 784
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Endocytosis   Toll Like Receptor 9 (TLR9) Cascade
Factors involved in megakaryocyte development and platelet production
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Congenital Neutropenia, Myelofibrosis, Nephromegaly Syndrome congenital neutropenia-myelofibrosis-nephromegaly syndrome N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Bone Diseases Metabolic Associate 25233840
Hypertriglyceridemia Associate 25233840
Lysosomal Storage Diseases Associate 25233840
Methylmalonic Aciduria and Homocystinuria CblF Type Associate 25233840
Multiple Organ Failure Associate 25233840
Neuraminidase deficiency with beta galactosidase deficiency Associate 25233840
Ovalocytosis Hereditary Hemolytic with Defective Erythropoiesis Associate 25233840
Primary Myelofibrosis Associate 29784638
Seizures Associate 25233840