Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	641372
Gene name Gene Name - the full gene name approved by the HGNC.	Acyl-CoA thioesterase 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ACOT6
Synonyms (NCBI Gene) Gene synonyms aliases	C14orf42, c14_5530
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q24.3

Show/Hide all(1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017207	hsa-miR-335-5p	Microarray	18185580

Show/Hide all(11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005737	Component	Cytoplasm	IEA
GO:0005777	Component	Peroxisome	IEA
GO:0005829	Component	Cytosol	IDA	16940157
GO:0006631	Process	Fatty acid metabolic process	IBA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006637	Process	Acyl-CoA metabolic process	IBA
GO:0006637	Process	Acyl-CoA metabolic process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016790	Function	Thiolester hydrolase activity	IEA
GO:0047617	Function	Fatty acyl-CoA hydrolase activity	IBA
GO:0052689	Function	Carboxylic ester hydrolase activity	IEA

MIM	HGNC	e!Ensembl
614267	33159	ENSG00000205669

Protein

UniProt ID

Q3I5F7

Protein name

Acyl-coenzyme A thioesterase 6 (Acyl-CoA thioesterase 6) (EC 3.1.2.-)

Protein function

Catalyzes the hydrolysis of acyl-CoAs into free fatty acids and coenzyme A (CoASH), regulating their respective intracellular levels. Catalyzes the hydrolysis of phytanoyl-CoA and pristanoyl-CoA, two methyl-branched fatty acids derived from phyt

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08840	BAAT_C	1 → 198	BAAT / Acyl-CoA thioester hydrolase C terminal	Domain

Sequence

MLQHPKVKGPSIALLGFSKGGDLCLSMASFLKGITATVLINACVANTVAPLHYKDMIIPK
LVDDLGKVKITKSGFLTFMDTWSNPLEEHNHQSLVPLEKAQVPFLFIVGMDDQSWKSEFY
AQIASERLQAHGKERPQIICYPETGHCIDPPYFPPSRASVHAVLGEAIFYGGEPKAHSKA
QVDAWQQIQTFFHKHLNGKKSVKHSKI

Sequence length

207

Interactions

View interactions

	Reactome
			Beta-oxidation of very long chain fatty acids

ACOT6 (acyl-CoA thioesterase 6)