Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	641371
Gene name Gene Name - the full gene name approved by the HGNC.	Acyl-CoA thioesterase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ACOT1
Synonyms (NCBI Gene) Gene synonyms aliases	ACH2, CTE-1, LACH2
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q24.3

Show/Hide all(8)

miRTarBase ID	miRNA	Experiments
MIRT2166096	hsa-miR-185	CLIP-seq
MIRT2166097	hsa-miR-3180-5p	CLIP-seq
MIRT2166098	hsa-miR-4306	CLIP-seq
MIRT2166099	hsa-miR-4644	CLIP-seq
MIRT2166100	hsa-miR-4717-5p	CLIP-seq
MIRT2166101	hsa-miR-4766-3p	CLIP-seq
MIRT2166102	hsa-miR-4768-3p	CLIP-seq
MIRT2166103	hsa-miR-665	CLIP-seq

Show/Hide all(13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000038	Process	Very long-chain fatty acid metabolic process	IDA	16940157
GO:0001676	Process	Long-chain fatty acid metabolic process	IDA	16940157
GO:0005829	Component	Cytosol	IDA	16940157
GO:0005829	Component	Cytosol	TAS
GO:0006631	Process	Fatty acid metabolic process	IBA	21873635
GO:0006637	Process	Acyl-CoA metabolic process	IBA	21873635
GO:0006637	Process	Acyl-CoA metabolic process	IDA	16940157
GO:0006637	Process	Acyl-CoA metabolic process	TAS
GO:0016290	Function	Palmitoyl-CoA hydrolase activity	IEA
GO:0047617	Function	Acyl-CoA hydrolase activity	IBA	21873635
GO:0047617	Function	Acyl-CoA hydrolase activity	IDA	16940157
GO:0052689	Function	Carboxylic ester hydrolase activity	IEA
GO:0102991	Function	Myristoyl-CoA hydrolase activity	IEA

MIM	HGNC	e!Ensembl
614313	33128	ENSG00000184227

Protein

UniProt ID

Q86TX2

Protein name

Acyl-coenzyme A thioesterase 1 (Acyl-CoA thioesterase 1) (EC 3.1.2.-) (CTE-I) (CTE-Ib) (Inducible cytosolic acyl-coenzyme A thioester hydrolase) (Long chain acyl-CoA thioester hydrolase) (Long chain acyl-CoA hydrolase) (Palmitoyl-coenzyme A thioesterase)

Protein function

Catalyzes the hydrolysis of acyl-CoAs into free fatty acids and coenzyme A (CoASH), regulating their respective intracellular levels. More active towards saturated and unsaturated long chain fatty acyl-CoAs (C12-C20). {ECO:0000269|PubMed:1694015

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04775	Bile_Hydr_Trans	16 → 141	Acyl-CoA thioester hydrolase/BAAT N-terminal region	Family
PF08840	BAAT_C	203 → 412	BAAT / Acyl-CoA thioester hydrolase C terminal	Domain

Sequence

MAATLILEPAGRCCWDEPVRIAVRGLAPEQPVTLRASLRDEKGALFQAHARYRADTLGEL
DLERAPALGGSFAGLEPMGLLWALEPEKPLVRLVKRDVRTPLAVELEVLDGHDPDPGRLL
CRVRHERYFLPPGVRREPVRAGRVRGTLFLPPEPGPFPGIVDMFGTGGGLLEYRASLLAG
KGFAVMALAYYNYEDLPKTMETLHLEYFEEAVNYLLSHPEVKGPGVGLLGISKGGELCLS
MASFLKGITAAVVINGSVANVGGTLRYKGETLPPVGVNRNRIKVTKDGYADIVDVLNSPL
EGPDQKSFIPVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGRRKPQIICYPETGH
YIEPPYFPLCRASLHALVGSPIIWGGEPRAHAMAQVDAWKQLQTFFHKHLGGHEGTIPSK
V

Sequence length

421

Interactions

View interactions

	KEGG		Reactome
	Fatty acid elongation Biosynthesis of unsaturated fatty acids Metabolic pathways Ovarian steroidogenesis		Mitochondrial Fatty Acid Beta-Oxidation

ACOT1 (acyl-CoA thioesterase 1)