Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
641339
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger protein 674
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZNF674
Synonyms (NCBI Gene) Gene synonyms aliases
MRX92, ZNF673B
Disease Acronyms (UniProt) Disease acronyms from UniProt database
MRX92
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xp11.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a zinc finger protein with an N-terminal Kruppel-associated box-containing (KRAB) domain and 11 Kruppel-type C2H2 zinc finger domains. Like other zinc finger proteins, this gene may function as a transcription factor. This gene resides o
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT661557 hsa-miR-490-3p HITS-CLIP 22927820
MIRT661556 hsa-miR-3714 HITS-CLIP 22927820
MIRT661555 hsa-miR-34b-3p HITS-CLIP 22927820
MIRT661554 hsa-miR-619-3p HITS-CLIP 22927820
MIRT706159 hsa-miR-890 HITS-CLIP 22927820
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA 21873635
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0001227 Function DNA-binding transcription repressor activity, RNA polymerase II-specific IBA 21873635
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300573 17625 ENSG00000251192
Protein
UniProt ID Q2M3X9
Protein name Zinc finger protein 674
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 7 48 KRAB box Family
PF00096 zf-C2H2 224 246 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 252 274 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 280 302 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 308 330 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 385 407 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 413 435 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 441 463 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 469 491 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 497 519 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 525 547 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 553 575 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in testis. {ECO:0000269|PubMed:16385466}.
Sequence
MAMSQESLTFKDVFVDFTLEEWQQLDSAQKNLYRDVMLENYSHLVSVGHLVGKPDVIFRL
GPGDESWMADGGTPVRTCAGEDRPEVWEVDEQIDHYKESQDKFLWQAAFIGKETLKDESG
QECKICRKIIYLNTDFVSVKQRLPKYYSWERCSKHHLNFLGQNRSYVRKKDDGCKAYWKV
CLHYNLHKAQPAERFFDPNQRGKALHQKQALRKSQRSQTGEKLYKCTECGKVFIQKANLV
VHQRTH
TGEKPYECCECAKAFSQKSTLIAHQRTHTGEKPYECSECGKTFIQKSTLIKHQR
TH
TGEKPFVCDKCPKAFKSSYHLIRHEKTHIRQAFYKGIKCTTSSLIYQRIHTSEKPQCS
EHGKASDEKPSPTKHWRTHTKENIYECSKCGKSFRGKSHLSVHQRIHTGEKPYECSICGK
TFSGKSHLSVHHRTH
TGEKPYECRRCGKAFGEKSTLIVHQRMHTGEKPYKCNECGKAFSE
KSPLIKHQRIH
TGERPYECTDCKKAFSRKSTLIKHQRIHTGEKPYKCSECGKAFSVKSTL
IVHHRTH
TGEKPYECRDCGKAFSGKSTLIKHQRSHTGDKNL
Sequence length 581
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Mental retardation Mental Retardation, X-Linked, Mental Retardation, X-Linked 92 rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315
View all (1024 more)
16385466, 23871722
Associations from Text Mining
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 27896271
Glioma Associate 30984540
Intellectual Disability Associate 22126752, 23871722
Mental Retardation X Linked Associate 16385466
Mental Retardation X Linked Nonsyndromic Associate 16385466
Neoplasm Metastasis Associate 27896271
Neoplasms Associate 27896271
Neuroblastoma Associate 38177154
Stomach Neoplasms Associate 35802620
Thyroid Neoplasms Associate 32377223