Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
64121
Gene name Gene Name - the full gene name approved by the HGNC.
Ras related GTP binding C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RRAGC
Synonyms (NCBI Gene) Gene synonyms aliases
GTR2, LNGODS, LNGOS, RAGC, TIB929
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p34.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the GTR/RAG GTP-binding protein family. The encoded protein is a monomeric guanine nucleotide-binding protein which forms a heterodimer with RRAGA and RRAGB and is primarily localized to the cytoplasm. The encoded protein pro
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019727 hsa-miR-375 Microarray 20215506
MIRT028929 hsa-miR-26b-5p Microarray 19088304
MIRT030696 hsa-miR-21-5p Microarray 18591254
MIRT051496 hsa-let-7e-5p CLASH 23622248
MIRT049975 hsa-miR-29a-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000045 Process Autophagosome assembly IDA 28890335
GO:0000166 Function Nucleotide binding IEA
GO:0000287 Function Magnesium ion binding NAS 11073942
GO:0002181 Process Cytoplasmic translation IDA 8706699, 34314702
GO:0003924 Function GTPase activity IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608267 19902 ENSG00000116954
Protein
UniProt ID Q9HB90
Protein name Ras-related GTP-binding protein C (Rag C) (RagC) (EC 3.6.5.-) (GTPase-interacting protein 2) (TIB929)
Protein function Guanine nucleotide-binding protein that plays a crucial role in the cellular response to amino acid availability through regulation of the mTORC1 signaling cascade (PubMed:20381137, PubMed:24095279, PubMed:27234373, PubMed:31601708, PubMed:31601
PDB 3LLU , 6CES , 6EHR , 6NZD , 6S6A , 6S6D , 6SB0 , 6SB2 , 6U62 , 6ULG , 6WJ2 , 6WJ3 , 7T3A , 7T3B , 7T3C , 7UX2 , 7UXC , 7UXH , 8DHB
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04670 Gtr1_RagA 63 289 Gtr1/RagA G protein conserved region Domain
Sequence
MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEEAAAAGGGVGAGAGGGCGPGGADSS
KPRILLMGLRRSGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQ
MDFFDPTFDYEMIFRGTGALIYVIDAQDDYMEALTRLHITVSKAYKVNPDMNFEVFIHKV
DGLSDDHKIETQRDIHQRANDDLADAGLEKLHLSFYLTSIYDHSIFEAFSKVVQKLIPQL
PTLENLLNIFISNSGIEKAFLFDVVSKIYIATDSSPVDMQSYELCCDMI
DVVIDVSCIYG
LKEDGSGSAYDKESMAIIKLNNTTVLYLKEVTKFLALVCILREESFERKGLIDYNFHCFR
KAIHEVFEVGVTSHRSCGHQTSASSLKALTHNGTPRNAI
Sequence length 399
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Autophagy - animal
mTOR signaling pathway
Shigellosis
  Macroautophagy
mTOR signalling
mTORC1-mediated signalling
Energy dependent regulation of mTOR by LKB1-AMPK
TP53 Regulates Metabolic Genes
Regulation of PTEN gene transcription
Amino acids regulate mTORC1
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Diabetes Severe autoimmune type 2 diabetes N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alcohol Related Disorders Associate 27234373
Carcinoma Hepatocellular Associate 32684241
Cardiomyopathy Dilated Associate 27234373, 37057673
Heart Failure Associate 27234373
Lissencephaly Associate 37057673
Lymphoma Follicular Associate 27267853, 37057673
Septo Optic Dysplasia Associate 37057673
Spinocerebellar Ataxias Associate 37057673