CRLF2 (cytokine receptor like factor 2)

Gene

• Entrez ID: 64109
• Gene name: Cytokine receptor like factor 2
• Gene symbol: CRLF2
• Synonyms (NCBI Gene): CRL2, CRLF2Y, TSLPR
• Chromosome: X|Y
• Chromosome location: X;Y
• Summary: This gene encodes a member of the type I cytokine receptor family. The encoded protein is a receptor for thymic stromal lymphopoietin (TSLP). Together with the interleukin 7 receptor (IL7R), the encoded protein and TSLP activate STAT3, STAT5, and JAK2 pat

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1057519743	A>C	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004896	Function	Cytokine receptor activity	IBA
GO:0004896	Function	Cytokine receptor activity	IDA	11418668
GO:0004896	Function	Cytokine receptor activity	IMP	17242164
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	11418668
GO:0009897	Component	External side of plasma membrane	IBA
GO:0015026	Function	Coreceptor activity	IDA	20974963
GO:0016020	Component	Membrane	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0019221	Process	Cytokine-mediated signaling pathway	IDA	11418668
GO:0019955	Function	Cytokine binding	IBA
GO:0032754	Process	Positive regulation of interleukin-5 production	IMP	17242164
GO:0033005	Process	Positive regulation of mast cell activation	IMP	17242164
GO:0043235	Component	Receptor complex	IBA
GO:1904894	Process	Positive regulation of receptor signaling pathway via STAT	IDA	11418668

Other IDs

• MIM: 300357
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q9HC73
• Protein name: Cytokine receptor-like factor 2 (Cytokine receptor-like 2) (IL-XR) (Thymic stromal lymphopoietin protein receptor) (TSLP receptor)
• Protein function: Receptor for thymic stromal lymphopoietin (TSLP). Forms a functional complex with TSLP and IL7R which is capable of stimulating cell proliferation through activation of STAT3 and STAT5. Also activates JAK2 (By similarity). Implicated in the deve
• PDB: 5J11, 5J12
• Tissue specificity: TISSUE SPECIFICITY: Expressed in heart, skeletal muscle, kidney and adult and fetal liver. Primarily expressed in dendrites and monocytes. Weakly expressed in T-cells.
• Sequence:

  MGRLVLLWGAAVFLLGGWMALGQGGAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHY
  RFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPS
  SPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKC
  YSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKFILISSLAI
  LLMVSLLLLSLWKLWRVKKFLIPSVPDPKSIFPGLFEIHQGNFQEWITDTQNVAHLHKMA
  GAEQESGPEEPLVVQLAKTEAESPRMLDPQTEEKEASGGSLQLPHQPLQGGDVVTIGGFT
  FVMNDRSYVAL

• Sequence length: 371

Pathways

KEGG:

Cytokine-cytokine receptor interaction
JAK-STAT signaling pathway

Reactome:

Interleukin-7 signaling