Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	64105
Gene name Gene Name - the full gene name approved by the HGNC.	Centromere protein K
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CENPK
Synonyms (NCBI Gene) Gene synonyms aliases	AF5alpha, CENP-K, FKSG14, P33, Solt
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q12.3
Summary Summary of gene provided in NCBI Entrez Gene.	CENPK is a subunit of a CENPH (MIM 605607)-CENPI (MIM 300065)-associated centromeric complex that targets CENPA (MIM 117139) to centromeres and is required for proper kinetochore function and mitotic progression (Okada et al., 2006 [PubMed 16622420]).[sup

Show/Hide all(84)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024346	hsa-miR-215-5p	Microarray	19074876
MIRT026538	hsa-miR-192-5p	Microarray	19074876
MIRT690237	hsa-miR-3662	HITS-CLIP	23313552
MIRT526198	hsa-miR-3646	HITS-CLIP	23313552
MIRT690236	hsa-miR-95-5p	HITS-CLIP	23313552
MIRT690235	hsa-miR-5589-3p	HITS-CLIP	23313552
MIRT690234	hsa-miR-885-3p	HITS-CLIP	23313552
MIRT690233	hsa-miR-106a-3p	HITS-CLIP	23313552
MIRT371526	hsa-miR-450b-5p	HITS-CLIP	23313552
MIRT690232	hsa-miR-507	HITS-CLIP	23313552
MIRT690231	hsa-miR-557	HITS-CLIP	23313552
MIRT690230	hsa-miR-3680-3p	HITS-CLIP	23313552
MIRT526198	hsa-miR-3646	PAR-CLIP	22012620
MIRT526199	hsa-miR-1252-3p	PAR-CLIP	22012620
MIRT371527	hsa-miR-4528	PAR-CLIP	22012620
MIRT526197	hsa-miR-6734-3p	PAR-CLIP	22012620
MIRT526196	hsa-miR-6759-3p	PAR-CLIP	22012620
MIRT526195	hsa-miR-374a-5p	PAR-CLIP	22012620
MIRT526194	hsa-miR-374b-5p	PAR-CLIP	22012620
MIRT690237	hsa-miR-3662	HITS-CLIP	23313552
MIRT526198	hsa-miR-3646	HITS-CLIP	23313552
MIRT690236	hsa-miR-95-5p	HITS-CLIP	23313552
MIRT690235	hsa-miR-5589-3p	HITS-CLIP	23313552
MIRT690234	hsa-miR-885-3p	HITS-CLIP	23313552
MIRT690233	hsa-miR-106a-3p	HITS-CLIP	23313552
MIRT371526	hsa-miR-450b-5p	HITS-CLIP	23313552
MIRT690232	hsa-miR-507	HITS-CLIP	23313552
MIRT690231	hsa-miR-557	HITS-CLIP	23313552
MIRT690230	hsa-miR-3680-3p	HITS-CLIP	23313552
MIRT526198	hsa-miR-3646	PAR-CLIP	22012620
MIRT526199	hsa-miR-1252-3p	PAR-CLIP	22012620
MIRT371527	hsa-miR-4528	PAR-CLIP	22012620
MIRT526197	hsa-miR-6734-3p	PAR-CLIP	22012620
MIRT526196	hsa-miR-6759-3p	PAR-CLIP	22012620
MIRT526195	hsa-miR-374a-5p	PAR-CLIP	22012620
MIRT526194	hsa-miR-374b-5p	PAR-CLIP	22012620
MIRT884955	hsa-let-7a	CLIP-seq
MIRT884956	hsa-let-7b	CLIP-seq
MIRT884957	hsa-let-7c	CLIP-seq
MIRT884958	hsa-let-7d	CLIP-seq
MIRT884959	hsa-let-7e	CLIP-seq
MIRT884960	hsa-let-7f	CLIP-seq
MIRT884961	hsa-let-7g	CLIP-seq
MIRT884962	hsa-let-7i	CLIP-seq
MIRT884963	hsa-miR-1273g	CLIP-seq
MIRT884964	hsa-miR-186	CLIP-seq
MIRT884965	hsa-miR-1914	CLIP-seq
MIRT884966	hsa-miR-202	CLIP-seq
MIRT884967	hsa-miR-25	CLIP-seq
MIRT884968	hsa-miR-3065-5p	CLIP-seq
MIRT884969	hsa-miR-3161	CLIP-seq
MIRT884970	hsa-miR-32	CLIP-seq
MIRT884971	hsa-miR-323-3p	CLIP-seq
MIRT884972	hsa-miR-323b-3p	CLIP-seq
MIRT884973	hsa-miR-362-5p	CLIP-seq
MIRT884974	hsa-miR-363	CLIP-seq
MIRT884975	hsa-miR-367	CLIP-seq
MIRT884976	hsa-miR-4307	CLIP-seq
MIRT884977	hsa-miR-4458	CLIP-seq
MIRT884978	hsa-miR-4500	CLIP-seq
MIRT884979	hsa-miR-4540	CLIP-seq
MIRT884980	hsa-miR-487a	CLIP-seq
MIRT884981	hsa-miR-500b	CLIP-seq
MIRT884982	hsa-miR-501-5p	CLIP-seq
MIRT884983	hsa-miR-548ag	CLIP-seq
MIRT884984	hsa-miR-548ai	CLIP-seq
MIRT884985	hsa-miR-92a	CLIP-seq
MIRT884986	hsa-miR-92b	CLIP-seq
MIRT884987	hsa-miR-98	CLIP-seq
MIRT884964	hsa-miR-186	CLIP-seq
MIRT2198851	hsa-miR-3680	CLIP-seq
MIRT2198852	hsa-miR-4420	CLIP-seq
MIRT2198853	hsa-miR-4422	CLIP-seq
MIRT2198854	hsa-miR-4427	CLIP-seq
MIRT2501645	hsa-miR-3607-3p	CLIP-seq
MIRT2501646	hsa-miR-3686	CLIP-seq
MIRT2501647	hsa-miR-374a	CLIP-seq
MIRT2501648	hsa-miR-374b	CLIP-seq
MIRT2501649	hsa-miR-4330	CLIP-seq
MIRT2501650	hsa-miR-4715-3p	CLIP-seq
MIRT2501651	hsa-miR-4777-3p	CLIP-seq
MIRT2501652	hsa-miR-548aa	CLIP-seq
MIRT2501653	hsa-miR-556-3p	CLIP-seq
MIRT2501654	hsa-miR-590-3p	CLIP-seq

Show/Hide all(7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000070	Process	Mitotic sister chromatid segregation	IBA	21873635
GO:0000941	Component	Condensed nuclear chromosome inner kinetochore	IBA	21873635
GO:0005515	Function	Protein binding	IPI	24981860, 25416956, 32296183
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	TAS
GO:0034080	Process	CENP-A containing nucleosome assembly	TAS
GO:0051382	Process	Kinetochore assembly	IEA

MIM	HGNC	e!Ensembl
611502	29479	ENSG00000123219

Protein

UniProt ID

Q9BS16

Protein name

Centromere protein K (CENP-K) (Interphase centromere complex protein 37) (Protein AF-5alpha) (p33)

Protein function

Component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. May be involved in incorporation of newly synthesiz

PDB

7PB4 , 7PKN , 7QOO , 7R5S , 7R5V , 7XHN , 7XHO , 7YWX , 7YYH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF11802	CENP-K	10 → 269	Centromere-associated protein K	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in several fetal organs with highest levels in fetal liver. In adults, it is weakly expressed in lung and placenta. {ECO:0000269|PubMed:8950979}.

Sequence

MNQEDLDPDSTTDVGDVTNTEEELIRECEEMWKDMEECQNKLSLIGTETLTDSNAQLSLL
IMQVKCLTAELSQWQKKTPETIPLTEDVLITLGKEEFQKLRQDLEMVLSTKESKNEKLKE
DLEREQRWLDEQQQIMESLNVLHSELKNKVETFSESRIFNELKTKMLNIKEYKEKLLSTL
GEFLEDHFPLPDRSVKKKKKNIQESSVNLITLHEMLEILINRLFDVPHDPYVKISDSFWP
PYVELLLRNGIALRHPEDPTRIRLEAFHQ

Sequence length

269

Interactions

View interactions

	Reactome
			Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal Separation of Sister Chromatids Resolution of Sister Chromatid Cohesion RHO GTPases Activate Formins Deposition of new CENPA-containing nucleosomes at the centromere Mitotic Prometaphase EML4 and NUDC in mitotic spindle formation

CENPK (centromere protein K)