Gene Gene information from NCBI Gene database.
Entrez ID 64097
Gene name Erythrocyte membrane protein band 4.1 like 4A
Gene symbol EPB41L4A
Synonyms (NCBI Gene)
EPB41L4NBL4
Chromosome 5
Chromosome location 5q22.1-q22.2
Summary The protein encoded by this gene is a member of the band 4.1 protein superfamily. Members of this superfamily are thought to play an important role in regulating interactions between the cytoskeleton and plasma membrane, and contain an amino terminal cons
SNPs SNP information provided by dbSNP.
1
SNP ID Visualize variation Clinical significance Consequence
rs730882207 G>A Likely-pathogenic Non coding transcript variant, coding sequence variant, missense variant, genic downstream transcript variant
miRNA miRNA information provided by mirtarbase database.
329
miRTarBase ID miRNA Experiments Reference
MIRT019149 hsa-miR-335-5p Microarray 18185580
MIRT965665 hsa-miR-1193 CLIP-seq
MIRT965666 hsa-miR-1273d CLIP-seq
MIRT965667 hsa-miR-1275 CLIP-seq
MIRT965668 hsa-miR-128 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IEA
GO:0005856 Component Cytoskeleton IBA
GO:0005856 Component Cytoskeleton IEA
GO:0008092 Function Cytoskeletal protein binding IEA
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
612141 13278 ENSG00000129595
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9HCS5
Protein name Band 4.1-like protein 4A (Erythrocyte membrane protein band 4.1-like 4A) (Protein NBL4)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09379 FERM_N 15 83 FERM N-terminal domain Domain
PF00373 FERM_M 102 211 FERM central domain Domain
PF09380 FERM_C 215 303 FERM C-terminal PH-like domain Domain
PF08736 FA 311 355 FERM adjacent (FA) Family
Tissue specificity TISSUE SPECIFICITY: Expressed in many tissues. High levels of expression in brain, liver, thymus and peripheral blood leukocytes and low levels of expression in heart, kidney, testis and colon.
Sequence
MGCFCAVPEEFYCEVLLLDESKLTLTTQQQGIKKSTKGSVVLDHVFHHVNLVEIDYFGLR
YCDRSHQTYWLDPAKTLAEHKEL
INTGPPYTLYFGIKFYAEDPCKLKEEITRYQFFLQVK
QDVLQGRLPCPVNTAAQLGAYAIQSELGDYDPYKHTAGYVSEYRFVPDQKEELEEAIERI
HKTLMGQIPSEAELNYLRTAKSLEMYGVDLH
PVYGENKSEYFLGLTPVGVVVYKNKKQVG
KYFWPRITKVHFKETQFELRVLGKDCNETSFFFEARSKTACKHLWKCSVEHHTFFRMPEN
ESN
SLSRKLSKFGSIRYKHRYSGRTALQMSRDLSIQLPRPDQNVTRSRSKTYPKRIAQTQ
PAESNSISRITANMENGENEGTIKIIAPSPVKSFKKAKNENSPDTQRSKSHAPWEENGPQ
SGLYNSPSDRTKSPKFPYTRRRNPSCGSDNDSVQPVRRRKAHNSGEDSDLKQRRRSRSRC
NTSSGSESENSNREYRKKRNRIRQENDMVDSAPQWEAVLRRQKEKNQADPNNRRSRHRSR
SRSPDIQAKEELWKHIQKELVDPSGLSEEQLKEIPYTKIETQGDPIRIRHSHSPRSYRQY
RRSQCSDGERSVLSEVNSKTDLVPPLPVTRSSDAQGSGDATVHQRRNGSKDSLMEEKPQT
STNNLAGKHTAKTIKTIQASRLKTET
Sequence length 686
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
5
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Failure to thrive Likely pathogenic rs730882207 RCV000162113
Spastic paraplegia Likely pathogenic rs730882207 RCV000162113
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Familial cancer of breast Uncertain significance rs189409879 RCV005932607
Gastric cancer Uncertain significance rs189409879 RCV005932608
Lung cancer Uncertain significance rs373479547 RCV005931224
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Inhibit 30764831, 36274054
Carcinoma Ductal Associate 30959550
Carcinoma Renal Cell Associate 34040677, 36611858
Carotid Stenosis Associate 36187128
Colorectal Neoplasms Associate 29703930
Diabetes Mellitus Associate 36187128
Diabetes Mellitus Type 2 Stimulate 35184403
Diabetes Mellitus Type 2 Associate 36187128
Dyskeratosis Congenita Associate 29703930
Insulin Resistance Stimulate 35184403