Gene Gene information from NCBI Gene database.
Entrez ID 64089
Gene name Sorting nexin 16
Gene symbol SNX16
Synonyms (NCBI Gene)
-
Chromosome 8
Chromosome location 8q21.13
Summary This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. The protein encoded by this gene associates with late end
miRNA miRNA information provided by mirtarbase database.
386
miRTarBase ID miRNA Experiments Reference
MIRT022579 hsa-miR-124-3p Microarray 18668037
MIRT027106 hsa-miR-103a-3p Sequencing 20371350
MIRT027924 hsa-miR-96-5p Sequencing 20371350
MIRT031652 hsa-miR-16-5p Sequencing 20371350
MIRT437592 hsa-miR-140-5p MicroarrayqRT-PCR 22815788
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
24
GO ID Ontology Definition Evidence Reference
GO:0001881 Process Receptor recycling IBA
GO:0005737 Component Cytoplasm IEA
GO:0005764 Component Lysosome IEA
GO:0005768 Component Endosome IEA
GO:0005769 Component Early endosome IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
614903 14980 ENSG00000104497
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P57768
Protein name Sorting nexin-16
Protein function May be involved in several stages of intracellular trafficking. Plays a role in protein transport from early to late endosomes. Plays a role in protein transport to the lysosome. Promotes degradation of EGFR after EGF signaling. Plays a role in
PDB 5GW0 , 5GW1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00787 PX 131 214 PX domain Domain
Tissue specificity TISSUE SPECIFICITY: Detected in placenta, lung, liver,heart and pancreas. {ECO:0000269|PubMed:12813048}.
Sequence
MATPYVPVPMPIGNSASSFTTNRNQRSSSFGSVSTSSNSSKGQLEDSNMGNFKQTSVPDQ
MDNTSSVCSSPLIRTKFTGTASSIEYSTRPRDTEEQNPETVNWEDRPSTPTILGYEVMEE
RAKFTVYKILVKKTPEESWVVFRRYTDFSRLNDKLKEMFPGFRLALPPKRWFKDNYNADF
LEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLD
DPPGPFDSLEESRAFCETLEETNYRL
QKELLEKQKEMESLKKLLSEKQLHIDTLENRIRTLSLEPEESLDVSETEGEQILKVESSA
LEVDQDVLDEESRADNKPCLSFSEPENAVSEIEVAEVAYDAEED
Sequence length 344
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ENDOMETRIOSIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Carcinoma Hepatocellular Associate 35482720
★☆☆☆☆
Found in Text Mining only
Glomerulonephritis Membranous Associate 24345872
★☆☆☆☆
Found in Text Mining only
Obesity Associate 28207535
★☆☆☆☆
Found in Text Mining only