Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	64078
Gene name	Solute carrier family 28 member 3
Gene symbol	SLC28A3
Synonyms (NCBI Gene)	CNT3
Chromosome	9
Chromosome location	9q21.32-q21.33
Summary	Nucleoside transporters, such as SLC28A3, regulate multiple cellular processes, including neurotransmission, vascular tone, adenosine concentration in the vicinity of cell surface receptors, and transport and metabolism of nucleoside drugs. SLC28A3 shows

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs885004	G>A	Drug-response	Intron variant

Show/Hide all (57)

miRTarBase ID	miRNA	Experiments
MIRT1358135	hsa-miR-1226	CLIP-seq
MIRT1358136	hsa-miR-1246	CLIP-seq
MIRT1358137	hsa-miR-1290	CLIP-seq
MIRT1358138	hsa-miR-29a	CLIP-seq
MIRT1358139	hsa-miR-29b	CLIP-seq
MIRT1358140	hsa-miR-29c	CLIP-seq
MIRT1358141	hsa-miR-3167	CLIP-seq
MIRT1358142	hsa-miR-320a	CLIP-seq
MIRT1358143	hsa-miR-320b	CLIP-seq
MIRT1358144	hsa-miR-320c	CLIP-seq
MIRT1358145	hsa-miR-320d	CLIP-seq
MIRT1358146	hsa-miR-338-3p	CLIP-seq
MIRT1358147	hsa-miR-3973	CLIP-seq
MIRT1358148	hsa-miR-4268	CLIP-seq
MIRT1358149	hsa-miR-4429	CLIP-seq
MIRT1358150	hsa-miR-4448	CLIP-seq
MIRT1358151	hsa-miR-4503	CLIP-seq
MIRT1358152	hsa-miR-4680-5p	CLIP-seq
MIRT1358153	hsa-miR-485-5p	CLIP-seq
MIRT1358154	hsa-miR-502-5p	CLIP-seq
MIRT1358155	hsa-miR-518a-5p	CLIP-seq
MIRT1358156	hsa-miR-527	CLIP-seq
MIRT1358157	hsa-miR-548a-3p	CLIP-seq
MIRT1358158	hsa-miR-548a-5p	CLIP-seq
MIRT1358159	hsa-miR-548ab	CLIP-seq
MIRT1358160	hsa-miR-548ak	CLIP-seq
MIRT1358161	hsa-miR-548b-5p	CLIP-seq
MIRT1358162	hsa-miR-548c-5p	CLIP-seq
MIRT1358163	hsa-miR-548d-5p	CLIP-seq
MIRT1358164	hsa-miR-548e	CLIP-seq
MIRT1358165	hsa-miR-548f	CLIP-seq
MIRT1358166	hsa-miR-548h	CLIP-seq
MIRT1358167	hsa-miR-548i	CLIP-seq
MIRT1358168	hsa-miR-548j	CLIP-seq
MIRT1358169	hsa-miR-548w	CLIP-seq
MIRT1358170	hsa-miR-548y	CLIP-seq
MIRT1358171	hsa-miR-559	CLIP-seq
MIRT1358172	hsa-miR-634	CLIP-seq
MIRT1358173	hsa-miR-660	CLIP-seq
MIRT1358174	hsa-miR-876-5p	CLIP-seq
MIRT1358175	hsa-miR-877	CLIP-seq
MIRT1358176	hsa-miR-935	CLIP-seq
MIRT1358173	hsa-miR-660	CLIP-seq
MIRT2459640	hsa-miR-515-5p	CLIP-seq
MIRT2459641	hsa-miR-548aa	CLIP-seq
MIRT2459642	hsa-miR-548ac	CLIP-seq
MIRT2459643	hsa-miR-548d-3p	CLIP-seq
MIRT2459644	hsa-miR-548z	CLIP-seq
MIRT2624481	hsa-miR-4291	CLIP-seq
MIRT2624482	hsa-miR-4310	CLIP-seq
MIRT2624483	hsa-miR-759	CLIP-seq
MIRT2691035	hsa-miR-208a	CLIP-seq
MIRT2691036	hsa-miR-208b	CLIP-seq
MIRT2691037	hsa-miR-3617	CLIP-seq
MIRT2691038	hsa-miR-499-5p	CLIP-seq
MIRT2459640	hsa-miR-515-5p	CLIP-seq
MIRT2691039	hsa-miR-641	CLIP-seq

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005337	Function	Nucleoside transmembrane transporter activity	IEA
GO:0005345	Function	Purine nucleobase transmembrane transporter activity	NAS	22492015
GO:0005415	Function	Nucleoside:sodium symporter activity	TAS
GO:0005515	Function	Protein binding	IPI	26481311
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0006855	Process	Xenobiotic transmembrane transport	TAS
GO:0015213	Function	Uridine transmembrane transporter activity	IDA	22492015
GO:0015293	Function	Symporter activity	IEA
GO:0015389	Function	Pyrimidine- and adenosine-specific:sodium symporter activity	IBA
GO:0015389	Function	Pyrimidine- and adenosine-specific:sodium symporter activity	IEA
GO:0015390	Function	Purine-specific nucleoside:sodium symporter activity	IBA
GO:0015390	Function	Purine-specific nucleoside:sodium symporter activity	IEA
GO:0015855	Process	Pyrimidine nucleobase transport	IEA
GO:0015860	Process	Purine nucleoside transmembrane transport	IBA
GO:0015860	Process	Purine nucleoside transmembrane transport	IEA
GO:0015862	Process	Uridine transmembrane transport	IDA	22492015
GO:0015864	Process	Pyrimidine nucleoside transport	IBA
GO:0015864	Process	Pyrimidine nucleoside transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0031526	Component	Brush border membrane	IEA
GO:0031526	Component	Brush border membrane	ISS
GO:0035725	Process	Sodium ion transmembrane transport	IEA
GO:0072531	Process	Pyrimidine-containing compound transmembrane transport	IDA	22492015
GO:1901642	Process	Nucleoside transmembrane transport	IDA	22492015
GO:1901642	Process	Nucleoside transmembrane transport	IEA
GO:1904823	Process	Purine nucleobase transmembrane transport	NAS	22492015

MIM	HGNC	e!Ensembl
608269	16484	ENSG00000197506

Q9HAS3

Protein name

Solute carrier family 28 member 3 (Concentrative Na(+)-nucleoside cotransporter 3) (CNT 3) (hCNT3)

Protein function

Sodium-dependent, pyrimidine- and purine-selective (PubMed:11032837, PubMed:15861042, PubMed:16446384, PubMed:17140564, PubMed:21998139). Involved in the homeostasis of endogenous nucleosides (PubMed:11032837, PubMed:15861042). Exhibits the tran

PDB

6KSW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01773	Nucleos_tra2_N	205 → 277	Na+ dependent nucleoside transporter N-terminus	Family
PF07670	Gate	285 → 385	Nucleoside recognition	Domain
PF07662	Nucleos_tra2_C	388 → 612	Na+ dependent nucleoside transporter C-terminus	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in pancreas, bone marrow, trachea, mammary gland, liver, prostate, and regions of intestine, brain, lung, placenta, testis, kidney, and heart. {ECO:0000269|PubMed:11032837}.

Sequence

MELRSTAAPRAEGYSNVGFQNEENFLENENTSGNNSIRSRAVQSREHTNTKQDEEQVTVE
QDSPRNREHMEDDDEEMQQKGCLERRYDTVCGFCRKHKTTLRHIIWGILLAGYLVMVISA
CVLNFHRALPLFVITVAAIFFVVWDHLMAKYEHRIDEMLSPGRRLLNSHWFWLKWVIWSS
LVLAVIFWLAFDTAKLGQQQLVSFGGLIMYIVLLFLFSKYPTRVYWRPVLWGIGLQFLLG
LLILRTDPGFIAFDWLGRQVQTFLEYTDAGASFVFGEKYKDHFFAFKVLPIVVFFSTVMS
MLYYLGLMQWIIRKVGWIMLVTTGSSPIESVVASGNIFVGQTESPLLVRPYLPYITKSEL
HAIMTAGFSTIAGSVLGAYISFGVPSSHLLTASVMSAPASLAAAKLFWPETEKPKITLKN
AMKMESGDSGNLLEAATQGASSSISLVANIAVNLIAFLALLSFMNSALSWFGNMFDYPQL
SFELICSYIFMPFSFMMGVEWQDSFMVARLIGYKTFFNEFVAYEHLSKWIHLRKEGGPKF
VNGVQQYISIRSEIIATYALCGFANIGSLGIVIGGLTSMAPSRKRDIASGAVRALIAGTV
ACFMTACIAGILSSTPVDINCHHVLENAFNSTFPGNTTKVIACCQSLLSSTVAKGPGEVI
PGGNHSLYSLKGCCTLLNPSTFNCNGISNTF

Sequence length

691

Interactions

View interactions

	Reactome
			Transport of nucleosides and free purine and pyrimidine bases across the plasma membrane

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Cervical cancer	Benign	rs7043492	RCV005904859
Uterine corpus endometrial carcinoma	Benign	rs7043492	RCV005904860

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Anemia	Associate	23195617
Carcinoma Non Small Cell Lung	Associate	22173087
Cardiomyopathies	Associate	30351207
Cardiotoxicity	Associate	33900042, 35110416
Drug Related Side Effects and Adverse Reactions	Associate	30927276, 36952646
Hemorrhage	Associate	36952646
Leukemia Lymphocytic Chronic B Cell	Associate	12411296, 30778771
Neoplasms	Associate	24300978, 36621142
Neurologic Manifestations	Associate	36952646
Neutropenia	Associate	30927276
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	36952646

SLC28A3 (solute carrier family 28 member 3)