SEMG2 (semenogelin 2)

Gene

• Entrez ID: 6407
• Gene name: Semenogelin 2
• Gene symbol: SEMG2
• Synonyms (NCBI Gene): SGII
• Chromosome: 20
• Chromosome location: 20q13.12
• Summary: The secreted protein encoded by this gene is involved in the formation of a gel matrix that encases ejaculated spermatozoa. Proteolysis by the prostate-specific antigen (PSA) breaks down the gel matrix and allows the spermatozoa to move more freely. The e

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023589	hsa-miR-1-3p	Microarray	18668037
MIRT032201	hsa-let-7b-5p	Proteomics	18668040
MIRT2323974	hsa-miR-3192	CLIP-seq
MIRT2323975	hsa-miR-3619-3p	CLIP-seq
MIRT2323976	hsa-miR-3649	CLIP-seq
MIRT2323977	hsa-miR-4314	CLIP-seq
MIRT2323978	hsa-miR-4646-5p	CLIP-seq
MIRT2323979	hsa-miR-4717-3p	CLIP-seq
MIRT2323980	hsa-miR-4776-5p	CLIP-seq
MIRT2323974	hsa-miR-3192	CLIP-seq
MIRT2459095	hsa-miR-346	CLIP-seq
MIRT2323976	hsa-miR-3649	CLIP-seq
MIRT2459096	hsa-miR-4294	CLIP-seq
MIRT2323977	hsa-miR-4314	CLIP-seq
MIRT2323978	hsa-miR-4646-5p	CLIP-seq
MIRT2323979	hsa-miR-4717-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001669	Component	Acrosomal vesicle	IBA
GO:0002020	Function	Protease binding	IPI	8665956
GO:0005515	Function	Protein binding	IPI	8665956
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	8665951, 8665956, 18714013
GO:0005615	Component	Extracellular space	TAS	1517240
GO:0005634	Component	Nucleus	HDA	21630459
GO:0008270	Function	Zinc ion binding	IMP	15563730
GO:0019731	Process	Antibacterial humoral response	IMP	18714013
GO:0048240	Process	Sperm capacitation	IBA
GO:0050817	Process	Coagulation	IDA	8665956
GO:0050817	Process	Coagulation	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:1900005	Process	Positive regulation of serine-type endopeptidase activity	IDA	15563730
GO:1901318	Process	Negative regulation of flagellated sperm motility	IEA

Other IDs

• MIM: 182141
• HGNC: 10743
• e!Ensembl: ENSG00000124157

Protein

• UniProt ID: Q02383
• Protein name: Semenogelin-2 (Semenogelin II) (SGII)
• Protein function: Participates in the formation of a gel matrix (sperm coagulum) entrapping the accessory gland secretions and ejaculated spermatozoa.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05474	Semenogelin	1 → 582	Semenogelin	Family

• Tissue specificity: TISSUE SPECIFICITY: Seminal vesicles, and to a much lesser extent, epididymis.
• Sequence:

  MKSIILFVLSLLLILEKQAAVMGQKGGSKGQLPSGSSQFPHGQKGQHYFGQKDQQHTKSK
  GSFSIQHTYHVDINDHDWTRKSQQYDLNALHKATKSKQHLGGSQQLLNYKQEGRDHDKSK
  GHFHMIVIHHKGGQAHHGTQNPSQDQGNSPSGKGLSSQCSNTEKRLWVHGLSKEQASASG
  AQKGRTQGGSQSSYVLQTEELVVNKQQRETKNSHQNKGHYQNVVDVREEHSSKLQTSLHP
  AHQDRLQHGPKDIFTTQDELLVYNKNQHQTKNLSQDQEHGRKAHKISYPSSRTEERQLHH
  GEKSVQKDVSKGSISIQTEEKIHGKSQNQVTIHSQDQEHGHKENKISYQSSSTEERHLNC
  GEKGIQKGVSKGSISIQTEEQIHGKSQNQVRIPSQAQEYGHKENKISYQSSSTEERRLNS
  GEKDVQKGVSKGSISIQTEEKIHGKSQNQVTIPSQDQEHGHKENKMSYQSSSTEERRLNY
  GGKSTQKDVSQSSISFQIEKLVEGKSQIQTPNPNQDQWSGQNAKGKSGQSADSKQDLLSH
  EQKGRYKQESSESHNIVITEHEVAQDDHLTQQYNEDRNPIST

• Sequence length: 582

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Carcinoma Ovarian Epithelial	Associate	33246661	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	33311447	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	33311447	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	33311447	★☆☆☆☆ Found in Text Mining only