Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	64063
Gene name	Serine protease 22
Gene symbol	PRSS22
Synonyms (NCBI Gene)	BSSP-4SP001LAhBSSP-4
Chromosome	16
Chromosome location	16p13.3
Summary	This gene encodes a member of the trypsin family of serine proteases. The enzyme is expressed in the airways in a developmentally regulated manner. The gene is part of a cluster of serine protease genes on chromosome 16. [provided by RefSeq, Jul 2008]

Show/Hide all (77)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021776	hsa-miR-132-3p	Microarray	17612493
MIRT700594	hsa-miR-98-5p	HITS-CLIP	23313552
MIRT700593	hsa-miR-4500	HITS-CLIP	23313552
MIRT700592	hsa-miR-4458	HITS-CLIP	23313552
MIRT700591	hsa-let-7g-5p	HITS-CLIP	23313552
MIRT700590	hsa-let-7f-5p	HITS-CLIP	23313552
MIRT700589	hsa-let-7e-5p	HITS-CLIP	23313552
MIRT700588	hsa-let-7d-5p	HITS-CLIP	23313552
MIRT700587	hsa-let-7b-5p	HITS-CLIP	23313552
MIRT700586	hsa-let-7a-5p	HITS-CLIP	23313552
MIRT700585	hsa-let-7c-5p	HITS-CLIP	23313552
MIRT700584	hsa-let-7i-5p	HITS-CLIP	23313552
MIRT700583	hsa-miR-3927-3p	HITS-CLIP	23313552
MIRT700582	hsa-miR-6831-5p	HITS-CLIP	23313552
MIRT700581	hsa-miR-4699-3p	HITS-CLIP	23313552
MIRT700580	hsa-miR-4257	HITS-CLIP	23313552
MIRT700579	hsa-miR-2114-3p	HITS-CLIP	23313552
MIRT700578	hsa-miR-6823-3p	HITS-CLIP	23313552
MIRT700577	hsa-miR-1908-5p	HITS-CLIP	23313552
MIRT700576	hsa-miR-663a	HITS-CLIP	23313552
MIRT700575	hsa-miR-6787-5p	HITS-CLIP	23313552
MIRT700574	hsa-miR-625-5p	HITS-CLIP	23313552
MIRT700573	hsa-miR-4451	HITS-CLIP	23313552
MIRT700594	hsa-miR-98-5p	HITS-CLIP	23313552
MIRT700593	hsa-miR-4500	HITS-CLIP	23313552
MIRT700592	hsa-miR-4458	HITS-CLIP	23313552
MIRT700591	hsa-let-7g-5p	HITS-CLIP	23313552
MIRT700590	hsa-let-7f-5p	HITS-CLIP	23313552
MIRT700589	hsa-let-7e-5p	HITS-CLIP	23313552
MIRT700588	hsa-let-7d-5p	HITS-CLIP	23313552
MIRT700587	hsa-let-7b-5p	HITS-CLIP	23313552
MIRT700586	hsa-let-7a-5p	HITS-CLIP	23313552
MIRT700585	hsa-let-7c-5p	HITS-CLIP	23313552
MIRT700584	hsa-let-7i-5p	HITS-CLIP	23313552
MIRT700583	hsa-miR-3927-3p	HITS-CLIP	23313552
MIRT700582	hsa-miR-6831-5p	HITS-CLIP	23313552
MIRT700581	hsa-miR-4699-3p	HITS-CLIP	23313552
MIRT700580	hsa-miR-4257	HITS-CLIP	23313552
MIRT700579	hsa-miR-2114-3p	HITS-CLIP	23313552
MIRT700578	hsa-miR-6823-3p	HITS-CLIP	23313552
MIRT700577	hsa-miR-1908-5p	HITS-CLIP	23313552
MIRT700576	hsa-miR-663a	HITS-CLIP	23313552
MIRT700575	hsa-miR-6787-5p	HITS-CLIP	23313552
MIRT700574	hsa-miR-625-5p	HITS-CLIP	23313552
MIRT700573	hsa-miR-4451	HITS-CLIP	23313552
MIRT1268447	hsa-let-7a	CLIP-seq
MIRT1268448	hsa-let-7b	CLIP-seq
MIRT1268449	hsa-let-7c	CLIP-seq
MIRT1268450	hsa-let-7d	CLIP-seq
MIRT1268451	hsa-let-7e	CLIP-seq
MIRT1268452	hsa-let-7f	CLIP-seq
MIRT1268453	hsa-let-7g	CLIP-seq
MIRT1268454	hsa-let-7i	CLIP-seq
MIRT1268455	hsa-miR-1908	CLIP-seq
MIRT1268456	hsa-miR-296-5p	CLIP-seq
MIRT1268457	hsa-miR-361-3p	CLIP-seq
MIRT1268458	hsa-miR-3927	CLIP-seq
MIRT1268459	hsa-miR-625	CLIP-seq
MIRT1268460	hsa-miR-663	CLIP-seq
MIRT1268461	hsa-miR-98	CLIP-seq
MIRT1268447	hsa-let-7a	CLIP-seq
MIRT1268448	hsa-let-7b	CLIP-seq
MIRT1268449	hsa-let-7c	CLIP-seq
MIRT1268450	hsa-let-7d	CLIP-seq
MIRT1268451	hsa-let-7e	CLIP-seq
MIRT1268452	hsa-let-7f	CLIP-seq
MIRT1268453	hsa-let-7g	CLIP-seq
MIRT1268454	hsa-let-7i	CLIP-seq
MIRT1268455	hsa-miR-1908	CLIP-seq
MIRT1268456	hsa-miR-296-5p	CLIP-seq
MIRT1268457	hsa-miR-361-3p	CLIP-seq
MIRT1268458	hsa-miR-3927	CLIP-seq
MIRT1268459	hsa-miR-625	CLIP-seq
MIRT1268460	hsa-miR-663	CLIP-seq
MIRT1268461	hsa-miR-98	CLIP-seq
MIRT2305134	hsa-miR-520d-5p	CLIP-seq
MIRT2305135	hsa-miR-524-5p	CLIP-seq

Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IDA	11602603
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	11602603
GO:0006508	Process	Proteolysis	IDA	11602603
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IBA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0010952	Process	Positive regulation of peptidase activity	IDA	15701722
GO:0016504	Function	Peptidase activator activity	IDA	15701722
GO:0016787	Function	Hydrolase activity	IEA

MIM	HGNC	e!Ensembl
609343	14368	ENSG00000005001

Q9GZN4

Protein name

Brain-specific serine protease 4 (BSSP-4) (EC 3.4.21.-) (Serine protease 22) (Serine protease 26) (Tryptase epsilon)

Protein function

Preferentially cleaves the synthetic substrate H-D-Leu-Thr-Arg-pNA compared to tosyl-Gly-Pro-Arg-pNA.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00089	Trypsin	50 → 285	Trypsin	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed abundantly in the epithelial cells of the airways, including trachea, esophagus and fetal lung. Scarce in adult lung. Expressed at low levels in placenta, pancreas, prostate and thyroid gland. {ECO:0000269|PubMed:11602603}.

Sequence

MVVSGAPPALGGGCLGTFTSLLLLASTAILNAARIPVPPACGKPQQLNRVVGGEDSTDSE
WPWIVSIQKNGTHHCAGSLLTSRWVITAAHCFKDNLNKPYLFSVLLGAWQLGNPGSRSQK
VGVAWVEPHPVYSWKEGACADIALVRLERSIQFSERVLPICLPDASIHLPPNTHCWISGW
GSIQDGVPLPHPQTLQKLKVPIIDSEVCSHLYWRGAGQGPITEDMLCAGYLEGERDACLG
DSGGPLMCQVDGAWLLAGIISWGEGCAERNRPGVYISLSAHRSWVEKIVQGVQLRGRAQG
GGALRAPSQGSGAAARS

Sequence length

317

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ERYTHEMATOSQUAMOUS DERMATOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEBORRHEIC DERMATITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	36414640	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Stimulate	36414640	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	36414640	★★★★★ ★☆☆☆☆ Found in Text Mining only

PRSS22 (serine protease 22)