SELP (selectin P)

Gene Gene information from NCBI Gene database.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 6403
Gene name Selectin P
Gene symbol SELP
Synonyms (NCBI Gene)
CD62CD62PGMP140GRMPLECAM3PADGEMPSEL
Chromosome 1
Chromosome location 1q24.2
Summary This gene encodes a 140 kDa protein that is stored in the alpha-granules of platelets and Weibel-Palade bodies of endothelial cells. This protein redistributes to the plasma membrane during platelet activation and degranulation and mediates the interactio
SNPs SNP information provided by dbSNP.
1
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (1)
SNP ID Visualize variation Clinical significance Consequence
rs730880284 C>G,T Likely-pathogenic Splice donor variant
miRNA miRNA information provided by mirtarbase database.
47
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (47)
miRTarBase ID miRNA Experiments Reference
MIRT735899 hsa-miR-1233-5p Flow cytometry 32485903
MIRT755612 hsa-miR-27a-3p qRT-PCR 35144666
MIRT1334306 hsa-miR-125a-3p CLIP-seq
MIRT1334307 hsa-miR-1297 CLIP-seq
MIRT1334308 hsa-miR-1299 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (2)
Transcription factor Regulation Reference
NFKB2 Activation 7559449
STAT6 Activation 10364072
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
53
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (53)
GO ID Ontology Definition Evidence Reference
GO:0001530 Function Lipopolysaccharide binding IMP 16514062
GO:0002687 Process Positive regulation of leukocyte migration IEA
GO:0005178 Function Integrin binding IDA 37184585
GO:0005509 Function Calcium ion binding IDA 11081633
GO:0005515 Function Protein binding IPI 9129046, 11081633, 11237770, 15633604, 18606703, 19118202, 26627825, 28011641, 37184585
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
173610 10721 ENSG00000174175
Protein Protein information from UniProt database.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P16109
Protein name P-selectin (CD62 antigen-like family member P) (Granule membrane protein 140) (GMP-140) (Leukocyte-endothelial cell adhesion molecule 3) (LECAM3) (Platelet activation dependent granule-external membrane protein) (PADGEM) (CD antigen CD62P)
Protein function Ca(2+)-dependent receptor for myeloid cells that binds to carbohydrates on neutrophils and monocytes. Mediates the interaction of activated endothelial cells or platelets with leukocytes. The ligand recognized is sialyl-Lewis X. Mediates rapid r
PDB 1FSB , 1G1Q , 1G1R , 1G1S , 1HES
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 49 → 160 Lectin C-type domain Domain
PF00084 Sushi 200 → 257 Sushi repeat (SCR repeat) Domain
PF00084 Sushi 262 → 319 Sushi repeat (SCR repeat) Domain
PF00084 Sushi 324 → 381 Sushi repeat (SCR repeat) Domain
PF00084 Sushi 386 → 443 Sushi repeat (SCR repeat) Domain
PF00084 Sushi 448 → 505 Sushi repeat (SCR repeat) Domain
PF00084 Sushi 510 → 567 Sushi repeat (SCR repeat) Domain
PF00084 Sushi 572 → 629 Sushi repeat (SCR repeat) Domain
PF00084 Sushi 642 → 699 Sushi repeat (SCR repeat) Domain
PF00084 Sushi 704 → 761 Sushi repeat (SCR repeat) Domain
Tissue specificity TISSUE SPECIFICITY: Stored in the alpha-granules of platelets and Weibel-Palade bodies of endothelial cells. Upon cell activation by agonists, P-selectin is transported rapidly to the cell surface.
Sequence 
MANCQIAILYQRFQRVVFGISQLLCFSALISELTNQKEVAAWTYHYSTKAYSWNISRKYC
QNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADN
EPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGN
YTCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDGYQVNGPS
KLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGFALVG
PEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCVHPLTAFAYGSSCKFECQPGYRV
RGLDMLRCIDSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGF
MLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNE
GLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCQFIC
DEGYSLSGPERLDCTRSGRWTDSPPMCEAIKCPELFAPEQGSLDCSDTRGEFNVGSTCHF
SCDNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGLQCPALTTPGQGTMYCRHHPG
TFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNL
WGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEALTYFGGAVA
STIGLIMGGTLLALLRKRFRQKDDGKCPLNPHSHLGTYGVFTNAAFDPSP
Sequence length 830
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Cell adhesion molecules
Neutrophil extracellular trap formation
Malaria
Staphylococcus aureus infection
Coronavirus disease - COVID-19
Lipid and atherosclerosis 		  Platelet degranulation
Cell surface interactions at the vascular wall
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
13
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Premature coronary artery atherosclerosis Likely pathogenic rs730880284 RCV000157648
Show/Hide Unknown Diseases (6)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Lung cancer Benign rs3917815 RCV005911978
RECLASSIFIED - SELP POLYMORPHISM Benign rs6133 RCV000014483
Sarcoma Benign rs3917815 RCV005911977
SELP POLYMORPHISM Benign rs6136 RCV006252374
Show/Hide Text Mining Associations (259)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acidosis Inhibit 30111342
Acute Coronary Syndrome Inhibit 12871333
Acute Coronary Syndrome Associate 32053880, 35109843
Acute Disease Stimulate 21733938
Acute Kidney Injury Associate 36416304
Adenocarcinoma of Lung Associate 22266541, 38011277
Adenocarcinoma of Lung Stimulate 22535539
Adenoma Associate 16565384
Aggressive Periodontitis Associate 21935407
Albuminuria Associate 16014051, 31023084