GPSM3 (G protein signaling modulator 3)

Gene

• Entrez ID: 63940
• Gene name: G protein signaling modulator 3
• Gene symbol: GPSM3
• Synonyms (NCBI Gene): AGS4, C6orf9, G18, G18.1a, G18.1b, G18.2, NG1
• Chromosome: 6
• Chromosome location: 6p21.32

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2006262	hsa-miR-512-5p	CLIP-seq
MIRT2450670	hsa-miR-125a-3p	CLIP-seq
MIRT2450671	hsa-miR-1266	CLIP-seq
MIRT2450672	hsa-miR-3150a-5p	CLIP-seq
MIRT2450673	hsa-miR-3150b-5p	CLIP-seq
MIRT2450674	hsa-miR-3612	CLIP-seq
MIRT2450675	hsa-miR-3664-3p	CLIP-seq
MIRT2450676	hsa-miR-3934	CLIP-seq
MIRT2450677	hsa-miR-4443	CLIP-seq
MIRT2450678	hsa-miR-4518	CLIP-seq
MIRT2450679	hsa-miR-650	CLIP-seq
MIRT2450680	hsa-miR-764	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002690	Process	Positive regulation of leukocyte chemotaxis	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 32814053, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0030695	Function	GTPase regulator activity	IEA
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IBA
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IEA

Other IDs

• MIM: 618558
• HGNC: 13945
• e!Ensembl: ENSG00000213654

Protein

• UniProt ID: Q9Y4H4
• Protein name: G-protein-signaling modulator 3 (Activator of G-protein signaling 4) (G18.1b) (Protein G18)
• Protein function: Interacts with subunit of G(i) alpha proteins and regulates the activation of G(i) alpha proteins.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02188	GoLoco	63 → 84	GoLoco motif	Motif
  PF02188	GoLoco	133 → 155	GoLoco motif	Motif

• Tissue specificity: TISSUE SPECIFICITY: Expressed in heart, placenta, lung and liver. {ECO:0000269|PubMed:15096500}.
• Sequence:

  MEAERPQEEEDGEQGPPQDEEGWPPPNSTTRPWRSAPPSPPPPGTRHTALGPRSASLLSL
  QTELLLDLVAEAQSRRLEEQRATFYTPQNPSSLAPAPLRPLEDREQLYSTILSHQCQRME
  AQRSEPPLPPGGQELLELLLRVQGGGRMEEQRSRPPTHTC

• Sequence length: 160

Pathways

KEGG:

NOD-like receptor signaling pathway

Reactome:

G alpha (i) signalling events