GPSM3 (G protein signaling modulator 3)

Gene

• Entrez ID: 63940
• Gene name: G protein signaling modulator 3
• Gene symbol: GPSM3
• Synonyms (NCBI Gene): AGS4, C6orf9, G18, G18.1a, G18.1b, G18.2, NG1
• Disease Acronyms (UniProt): AGS4
• Chromosome: 6
• Chromosome location: 6p21.32

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2006262	hsa-miR-512-5p	CLIP-seq
MIRT2450670	hsa-miR-125a-3p	CLIP-seq
MIRT2450671	hsa-miR-1266	CLIP-seq
MIRT2450672	hsa-miR-3150a-5p	CLIP-seq
MIRT2450673	hsa-miR-3150b-5p	CLIP-seq
MIRT2450674	hsa-miR-3612	CLIP-seq
MIRT2450675	hsa-miR-3664-3p	CLIP-seq
MIRT2450676	hsa-miR-3934	CLIP-seq
MIRT2450677	hsa-miR-4443	CLIP-seq
MIRT2450678	hsa-miR-4518	CLIP-seq
MIRT2450679	hsa-miR-650	CLIP-seq
MIRT2450680	hsa-miR-764	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002690	Process	Positive regulation of leukocyte chemotaxis	IEA
GO:0003674	Function	Molecular_function	ND
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 32814053
GO:0005575	Component	Cellular_component	ND
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0008150	Process	Biological_process	ND
GO:0030695	Function	GTPase regulator activity	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IBA	21873635
GO:0050790	Process	Regulation of catalytic activity	IEA
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IEA

Other IDs

• MIM: 618558
• HGNC: 13945
• e!Ensembl: ENSG00000213654

Protein

• UniProt ID: Q9Y4H4
• Protein name: G-protein-signaling modulator 3 (Activator of G-protein signaling 4) (G18.1b) (Protein G18)
• Protein function: Interacts with subunit of G(i) alpha proteins and regulates the activation of G(i) alpha proteins.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02188	GoLoco	63 → 84	GoLoco motif	Motif
  PF02188	GoLoco	133 → 155	GoLoco motif	Motif

• Tissue specificity: TISSUE SPECIFICITY: Expressed in heart, placenta, lung and liver. {ECO:0000269|PubMed:15096500}.
• Sequence:

  MEAERPQEEEDGEQGPPQDEEGWPPPNSTTRPWRSAPPSPPPPGTRHTALGPRSASLLSL
  QTELLLDLVAEAQSRRLEEQRATFYTPQNPSSLAPAPLRPLEDREQLYSTILSHQCQRME
  AQRSEPPLPPGGQELLELLLRVQGGGRMEEQRSRPPTHTC

• Sequence length: 160

Pathways

KEGG:

NOD-like receptor signaling pathway

Reactome:

G alpha (i) signalling events

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Diabetes mellitus	Diabetes Mellitus, Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs80356663, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs371977235, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261	17632545
Myasthenia gravis	Myasthenia Gravis	rs5030818, rs121912815, rs121912817, rs121912818, rs121912821, rs75466054, rs121912822, rs121912823, rs794727516, rs764497513, rs376808313, rs1279554995, rs1554802792, rs369251527, rs372760913, rs1554802808, rs769234940, rs201439531, rs1272947184, rs757303526, rs760936252, rs1590576560, rs1838635262	23055271
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	21156761, 17804836

Unknown
Disease term	Disease name	Evidence	References	Source
Coronary heart disease	Coronary heart disease		21971053	ClinVar
Dermatitis	Dermatitis			GWAS
Pancreatic cancer	Pancreatic cancer	Genome-Wide CRISPR Screening Identifies DCK and CCNL1 as Genes That Contribute to Gemcitabine Resistance in Pancreatic Cancer		GWAS, CBGDA

Associations from Text Mining
Disease Name	Relationship Type	References
Arthritis	Associate	26821282, 27307211
Arthritis Rheumatoid	Associate	26821282, 27307211
beta Thalassemia	Associate	14587045
Mevalonate Kinase Deficiency	Associate	29268706