GPSM3 (G protein signaling modulator 3)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
63940
Gene name Gene Name - the full gene name approved by the HGNC.
G protein signaling modulator 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GPSM3
Synonyms (NCBI Gene) Gene synonyms aliases
AGS4, C6orf9, G18, G18.1a, G18.1b, G18.2, NG1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.32
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(12)
miRTarBase ID miRNA Experiments Reference
MIRT2006262 hsa-miR-512-5p CLIP-seq
MIRT2450670 hsa-miR-125a-3p CLIP-seq
MIRT2450671 hsa-miR-1266 CLIP-seq
MIRT2450672 hsa-miR-3150a-5p CLIP-seq
MIRT2450673 hsa-miR-3150b-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(9)
GO ID Ontology Definition Evidence Reference
GO:0002690 Process Positive regulation of leukocyte chemotaxis IEA
GO:0005515 Function Protein binding IPI 25416956, 32296183, 32814053, 33961781
GO:0005737 Component Cytoplasm IEA
GO:0005886 Component Plasma membrane IEA
GO:0030695 Function GTPase regulator activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
618558 13945 ENSG00000213654
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9Y4H4
Protein name G-protein-signaling modulator 3 (Activator of G-protein signaling 4) (G18.1b) (Protein G18)
Protein function Interacts with subunit of G(i) alpha proteins and regulates the activation of G(i) alpha proteins.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02188 GoLoco 63 → 84 GoLoco motif Motif
PF02188 GoLoco 133 → 155 GoLoco motif Motif
Tissue specificity TISSUE SPECIFICITY: Expressed in heart, placenta, lung and liver. {ECO:0000269|PubMed:15096500}.
Sequence 
MEAERPQEEEDGEQGPPQDEEGWPPPNSTTRPWRSAPPSPPPPGTRHTALGPRSASLLSL
QTELLLDLVAEAQSRRLEEQRATFYTPQNPSSLAPAPLRPLEDREQLYSTILSHQCQRME
AQRSEPPLPPGGQELLELLLRVQGGGRMEEQRSRPPTHTC
Sequence length 160
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  NOD-like receptor signaling pathway   G alpha (i) signalling events
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Dermatitis Atopic dermatitis N/A N/A GWAS
Pancreatic cancer Pancreatic cancer N/A N/A GWAS
Show/Hide Text Mining Associations (4)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Associate 26821282, 27307211
Arthritis Rheumatoid Associate 26821282, 27307211
beta Thalassemia Associate 14587045
Mevalonate Kinase Deficiency Associate 29268706