Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	63910
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 17 member 9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC17A9
Synonyms (NCBI Gene) Gene synonyms aliases	C20orf59, POROK8, VNUT
Disease Acronyms (UniProt) Disease acronyms from UniProt database	POROK8
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20q13.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of a family of transmembrane proteins that are involved in the transport of small molecules. The encoded protein participates in the vesicular uptake, storage, and secretion of adenoside triphosphate (ATP) and other nucleotides.

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs548728088	C>A,T	Pathogenic	Non coding transcript variant, 5 prime UTR variant, coding sequence variant, missense variant
rs606231251	G>A	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant

Show/Hide all(53)

miRTarBase ID	miRNA	Experiments	Reference
MIRT755320	hsa-miR-3150a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	34900992
MIRT1353577	hsa-miR-187	CLIP-seq
MIRT1353578	hsa-miR-2110	CLIP-seq
MIRT1353579	hsa-miR-3665	CLIP-seq
MIRT1353580	hsa-miR-3921	CLIP-seq
MIRT1353581	hsa-miR-4271	CLIP-seq
MIRT1353582	hsa-miR-4522	CLIP-seq
MIRT1353583	hsa-miR-4649-3p	CLIP-seq
MIRT1353584	hsa-miR-4653-5p	CLIP-seq
MIRT1353585	hsa-miR-4714-5p	CLIP-seq
MIRT1353586	hsa-miR-4725-3p	CLIP-seq
MIRT1353587	hsa-miR-4736	CLIP-seq
MIRT1353588	hsa-miR-4738-3p	CLIP-seq
MIRT1353589	hsa-miR-491-5p	CLIP-seq
MIRT1353590	hsa-miR-516a-5p	CLIP-seq
MIRT2104636	hsa-miR-1207-5p	CLIP-seq
MIRT1353583	hsa-miR-4649-3p	CLIP-seq
MIRT1353588	hsa-miR-4738-3p	CLIP-seq
MIRT2104637	hsa-miR-4763-3p	CLIP-seq
MIRT2329089	hsa-miR-122	CLIP-seq
MIRT2329090	hsa-miR-1226	CLIP-seq
MIRT2329091	hsa-miR-1293	CLIP-seq
MIRT2329092	hsa-miR-1343	CLIP-seq
MIRT2329093	hsa-miR-188-3p	CLIP-seq
MIRT2329094	hsa-miR-3155	CLIP-seq
MIRT2329095	hsa-miR-3155b	CLIP-seq
MIRT2329096	hsa-miR-3612	CLIP-seq
MIRT2329097	hsa-miR-3657	CLIP-seq
MIRT2329098	hsa-miR-3691-3p	CLIP-seq
MIRT2329099	hsa-miR-4267	CLIP-seq
MIRT2329100	hsa-miR-4283	CLIP-seq
MIRT2329101	hsa-miR-4443	CLIP-seq
MIRT2329102	hsa-miR-4483	CLIP-seq
MIRT2329103	hsa-miR-4489	CLIP-seq
MIRT2329104	hsa-miR-4651	CLIP-seq
MIRT2329105	hsa-miR-4669	CLIP-seq
MIRT2329106	hsa-miR-484	CLIP-seq
MIRT2329107	hsa-miR-566	CLIP-seq
MIRT2329108	hsa-miR-603	CLIP-seq
MIRT2329109	hsa-miR-608	CLIP-seq
MIRT2329110	hsa-miR-650	CLIP-seq
MIRT2329111	hsa-miR-661	CLIP-seq
MIRT2329111	hsa-miR-661	CLIP-seq
MIRT2623524	hsa-miR-3692	CLIP-seq
MIRT2623525	hsa-miR-4464	CLIP-seq
MIRT2623526	hsa-miR-4684-5p	CLIP-seq
MIRT2623527	hsa-miR-4748	CLIP-seq
MIRT2623528	hsa-miR-4768-5p	CLIP-seq
MIRT2623524	hsa-miR-3692	CLIP-seq
MIRT2623525	hsa-miR-4464	CLIP-seq
MIRT2623526	hsa-miR-4684-5p	CLIP-seq
MIRT2623527	hsa-miR-4748	CLIP-seq
MIRT2623528	hsa-miR-4768-5p	CLIP-seq

Show/Hide all(13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001409	Function	Guanine nucleotide transmembrane transporter activity	IMP	18375752
GO:0005347	Function	ATP transmembrane transporter activity	IDA	18375752
GO:0005347	Function	ATP transmembrane transporter activity	IMP	18375752
GO:0005515	Function	Protein binding	IPI	32296183
GO:0006887	Process	Exocytosis	IEA
GO:0015217	Function	ADP transmembrane transporter activity	IMP	18375752
GO:0015866	Process	ADP transport	IMP	18375752
GO:0015867	Process	ATP transport	IDA	18375752
GO:0015867	Process	ATP transport	IMP	18375752
GO:0016021	Component	Integral component of membrane	IEA
GO:0042584	Component	Chromaffin granule membrane	IEA
GO:1903790	Process	Guanine nucleotide transmembrane transport	IMP	18375752
GO:1904669	Process	ATP export	IEA

MIM	HGNC	e!Ensembl
612107	16192	ENSG00000101194

Protein

UniProt ID

Q9BYT1

Protein name

Voltage-gated purine nucleotide uniporter SLC17A9 (Solute carrier family 17 member 9) (Vesicular nucleotide transporter) (VNUT)

Protein function

Voltage-gated ATP nucleotide uniporter that can also transport the purine nucleotides ADP and GTP. Uses the membrane potential as the driving force to control ATP accumulation in lysosomes and secretory vesicles (PubMed:18375752, PubMed:23467297

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07690	MFS_1	30 → 387	Major Facilitator Superfamily	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed, but more predominantly in adrenal gland, brain and thyroid. {ECO:0000269|PubMed:18375752}.

Sequence

MQPPPDEARRDMAGDTQWSRPECQAWTGTLLLGTCLLYCARSSMPICTVSMSQDFGWNKK
EAGIVLSSFFWGYCLTQVVGGHLGDRIGGEKVILLSASAWGSITAVTPLLAHLSSAHLAF
MTFSRILMGLLQGVYFPALTSLLSQKVRESERAFTYSIVGAGSQFGTLLTGAVGSLLLEW
YGWQSIFYFSGGLTLLWVWYVYRYLLSEKDLILALGVLAQSRPVSRHNRVPWRRLFRKPA
VWAAVVSQLSAACSFFILLSWLPTFFEETFPDAKGWIFNVVPWLVAIPASLFSGFLSDHL
INQGYRAITVRKLMQGMGLGLSSVFALCLGHTSSFCESVVFASASIGLQTFNHSGISVNI
QDLAPSCAGFLFGVANTAGALAGVVGVCLGGYLMETTGSWTCLFNLVAIISNLGLCTFLV
FGQAQRVDLSSTHEDL

Sequence length

436

Interactions

View interactions

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Carcinoma	Squamous cell carcinoma	rs121912654, rs555607708, rs786202962, rs1564055259
Porokeratosis	Porokeratosis, Porokeratosis, Disseminated Superficial Actinic, POROKERATOSIS 8, DISSEMINATED SUPERFICIAL ACTINIC TYPE	rs397514570, rs104895301, rs104895373, rs397514571, rs398122910, rs398122911, rs606231251, rs863225241, rs769193201, rs104895362, rs761991070, rs755948940	25596766, 25180256

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Disseminated Superficial Actinic Porokeratosis	disseminated superficial actinic porokeratosis			GenCC

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining
Carcinoma Renal Cell	Associate	40302348
Diabetes Gestational	Associate	36313769
Hepatitis B Chronic	Associate	40480312
Inflammation	Associate	40480312
Kidney Neoplasms	Associate	40302348
Neuralgia	Associate	35266813
Pain	Associate	35266813
Phantom Limb	Associate	35266813
Stomach Neoplasms	Associate	31799885

SLC17A9 (solute carrier family 17 member 9)