Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
63901
Gene name Gene Name - the full gene name approved by the HGNC.
FAM111 trypsin like peptidase A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FAM111A
Synonyms (NCBI Gene) Gene synonyms aliases
GCLEB, KCS2
Disease Acronyms (UniProt) Disease acronyms from UniProt database
GCLEB, KCS2
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q12.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is cell-cycle regulated, and has nuclear localization. The C-terminal half of the protein shares homology with trypsin-like peptidases and it contains a PCNA-interacting peptide (PIP) box, that is necessary for its co-loca
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs587777011 G>A Pathogenic, conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant
rs587777012 T>C Conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant
rs587777013 A>G,T Pathogenic-likely-pathogenic Coding sequence variant, missense variant
rs587777014 A>G Pathogenic-likely-pathogenic Coding sequence variant, missense variant
rs587777015 C>A,G Pathogenic-likely-pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016290 hsa-miR-193b-3p Microarray 20304954
MIRT977194 hsa-miR-1183 CLIP-seq
MIRT977195 hsa-miR-1273f CLIP-seq
MIRT977196 hsa-miR-143 CLIP-seq
MIRT977197 hsa-miR-3074-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IBA 21873635
GO:0000785 Component Chromatin IDA 24561620
GO:0001650 Component Fibrillar center IDA
GO:0003697 Function Single-stranded DNA binding IDA 32165630
GO:0005515 Function Protein binding IPI 23093934, 24561620
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
615292 24725 ENSG00000166801
Protein
UniProt ID Q96PZ2
Protein name Serine protease FAM111A (EC 3.4.21.-)
Protein function Single-stranded DNA-binding serine protease that mediates the proteolytic cleavage of covalent DNA-protein cross-links (DPCs) during DNA synthesis, thereby playing a key role in maintaining genomic integrity (PubMed:32165630). DPCs are highly to
PDB 8S9K , 8S9L
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13365 Trypsin_2 370 555 Domain
Sequence
MSCKKQRSRKHSVNEKCNMKIEHYFSPVSKEQQNNCSTSLMRMESRGDPRATTNTQAQRF
HSPKKNPEDQTMPQNRTIYVTLKVNHRRNQDMKLKLTHSENSSLYMALNTLQAVRKEIET
HQGQEMLVRGTEGIKEYINLGMPLSCFPEGGQVVITFSQSKSKQKEDNHIFGRQDKASTE
CVKFYIHAIGIGKCKRRIVKCGKLHKKGRKLCVYAFKGETIKDALCKDGRFLSFLENDDW
KLIENNDTILESTQPVDELEGRYFQVEVEKRMVPSAAASQNPESEKRNTCVLREQIVAQY
PSLKRESEKIIENFKKKMKVKNGETLFELHRTTFGKVTKNSSSIKVVKLLVRLSDSVGYL
FWDSATTGYATCFVFKGLFILTCRHVIDSIVGDGIEPSKWATIIGQCVRVTFGYEELKDK
ETNYFFVEPWFEIHNEELDYAVLKLKENGQQVPMELYNGITPVPLSGLIHIIGHPYGEKK
QIDACAVIPQGQRAKKCQERVQSKKAESPEYVHMYTQRSFQKIVHNPDVITYDTEFFFGA
SGSPVFDSKGSLVAM
HAAGFAYTYQNETRSIIEFGSTMESILLDIKQRHKPWYEEVFVNQ
QDVEMMSDEDL
Sequence length 611
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Anemia Anemia rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966
View all (89 more)
Aniridia Aniridia rs1565200471, rs121907912, rs121907915, rs121907913, rs121907914, rs1131692318, rs121907916, rs121907917, rs794726661, rs121907918, rs121907920, rs121907922, rs121907927, rs121907928, rs878852979
View all (159 more)
Brachydactyly Brachydactyly rs121908949, rs28937580, rs121909082, rs104894122, rs863223289, rs863223290, rs104894121, rs1587657302, rs863223292, rs74315386, rs74315387, rs28936397, rs753691079, rs121909348, rs121917852
View all (22 more)
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Unknown
Disease term Disease name Evidence References Source
Prostate cancer Prostate cancer Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population. GWAS, CBGDA
Associations from Text Mining
Disease Name Relationship Type References
Aicardi Goutieres syndrome Associate 32996714
Carcinoma Hepatocellular Associate 37400994
Developmental Disabilities Associate 23684011
Epileptic Encephalopathy Early Infantile 3 Associate 37793778
Gracile bone dysplasia Associate 23684011, 32776417
Hypoparathyroidism Associate 23684011, 31433868
Kenny Caffey syndrome Type 1 Associate 23684011, 32776417, 37793778
Kenny Caffey syndrome type 2 Associate 23996431, 32996714
Multiple System Atrophy Associate 32776417
Muscular Dystrophy Duchenne Associate 36619896