Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6386
Gene name Gene Name - the full gene name approved by the HGNC.	Syndecan binding protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SDCBP
Synonyms (NCBI Gene) Gene synonyms aliases	MDA-9, MDA9, SDCBP1, ST1, SYCL, TACIP18
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q12.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of tran

Show/Hide all(225)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001503	hsa-miR-155-5p	pSILAC	18668040
MIRT001503	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT001503	hsa-miR-155-5p	Proteomics	18668040
MIRT027019	hsa-miR-103a-3p	Sequencing	20371350
MIRT028447	hsa-miR-30a-5p	Proteomics	18668040
MIRT050190	hsa-miR-26a-5p	CLASH	23622248
MIRT001503	hsa-miR-155-5p	Immunocytochemistry, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24604078
MIRT574212	hsa-miR-5197-3p	PAR-CLIP	20371350
MIRT225350	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT225352	hsa-miR-885-5p	PAR-CLIP	20371350
MIRT574211	hsa-miR-6831-3p	PAR-CLIP	20371350
MIRT225351	hsa-miR-587	PAR-CLIP	20371350
MIRT106002	hsa-miR-548an	PAR-CLIP	20371350
MIRT105998	hsa-miR-3714	PAR-CLIP	20371350
MIRT565822	hsa-miR-944	PAR-CLIP	20371350
MIRT106000	hsa-miR-3942-5p	PAR-CLIP	20371350
MIRT106003	hsa-miR-4703-5p	PAR-CLIP	20371350
MIRT364023	hsa-miR-3119	PAR-CLIP	20371350
MIRT105997	hsa-miR-629-5p	PAR-CLIP	20371350
MIRT105999	hsa-miR-3940-5p	PAR-CLIP	20371350
MIRT106001	hsa-miR-4507	PAR-CLIP	20371350
MIRT106005	hsa-miR-6839-3p	PAR-CLIP	20371350
MIRT733993	hsa-miR-1273a	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR, Flow cytometry, ELISA	32901857
MIRT574212	hsa-miR-5197-3p	PAR-CLIP	20371350
MIRT225350	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT225352	hsa-miR-885-5p	PAR-CLIP	20371350
MIRT574211	hsa-miR-6831-3p	PAR-CLIP	20371350
MIRT225351	hsa-miR-587	PAR-CLIP	20371350
MIRT106002	hsa-miR-548an	PAR-CLIP	20371350
MIRT105998	hsa-miR-3714	PAR-CLIP	20371350
MIRT565822	hsa-miR-944	PAR-CLIP	20371350
MIRT106000	hsa-miR-3942-5p	PAR-CLIP	20371350
MIRT106003	hsa-miR-4703-5p	PAR-CLIP	20371350
MIRT364023	hsa-miR-3119	PAR-CLIP	20371350
MIRT105997	hsa-miR-629-5p	PAR-CLIP	20371350
MIRT105999	hsa-miR-3940-5p	PAR-CLIP	20371350
MIRT106001	hsa-miR-4507	PAR-CLIP	20371350
MIRT106005	hsa-miR-6839-3p	PAR-CLIP	20371350
MIRT1331598	hsa-miR-216b	CLIP-seq
MIRT1331599	hsa-miR-3653	CLIP-seq
MIRT1331600	hsa-miR-3658	CLIP-seq
MIRT1331601	hsa-miR-4635	CLIP-seq
MIRT1331602	hsa-miR-154	CLIP-seq
MIRT1331603	hsa-miR-3667-5p	CLIP-seq
MIRT1331604	hsa-miR-3973	CLIP-seq
MIRT1331605	hsa-miR-4733-5p	CLIP-seq
MIRT1331606	hsa-miR-562	CLIP-seq
MIRT1331607	hsa-miR-329	CLIP-seq
MIRT1331608	hsa-miR-3607-3p	CLIP-seq
MIRT1331609	hsa-miR-362-3p	CLIP-seq
MIRT1331610	hsa-miR-3686	CLIP-seq
MIRT1331611	hsa-miR-3941	CLIP-seq
MIRT1331612	hsa-miR-466	CLIP-seq
MIRT1331613	hsa-miR-4672	CLIP-seq
MIRT1331614	hsa-miR-548aa	CLIP-seq
MIRT1331615	hsa-miR-603	CLIP-seq
MIRT1331603	hsa-miR-3667-5p	CLIP-seq
MIRT1331604	hsa-miR-3973	CLIP-seq
MIRT1331616	hsa-miR-4263	CLIP-seq
MIRT1331605	hsa-miR-4733-5p	CLIP-seq
MIRT1331606	hsa-miR-562	CLIP-seq
MIRT1331617	hsa-miR-629	CLIP-seq
MIRT2098027	hsa-miR-488	CLIP-seq
MIRT2098028	hsa-miR-561	CLIP-seq
MIRT2322630	hsa-miR-369-3p	CLIP-seq
MIRT2322631	hsa-miR-374c	CLIP-seq
MIRT2322632	hsa-miR-655	CLIP-seq
MIRT2322633	hsa-miR-103a	CLIP-seq
MIRT2322634	hsa-miR-105	CLIP-seq
MIRT2322635	hsa-miR-107	CLIP-seq
MIRT2322636	hsa-miR-1273	CLIP-seq
MIRT2322637	hsa-miR-145	CLIP-seq
MIRT2322638	hsa-miR-149	CLIP-seq
MIRT2322639	hsa-miR-196a	CLIP-seq
MIRT2322640	hsa-miR-196b	CLIP-seq
MIRT1331598	hsa-miR-216b	CLIP-seq
MIRT2322641	hsa-miR-221	CLIP-seq
MIRT2322642	hsa-miR-222	CLIP-seq
MIRT2322643	hsa-miR-3123	CLIP-seq
MIRT2322644	hsa-miR-3143	CLIP-seq
MIRT2322645	hsa-miR-3180-5p	CLIP-seq
MIRT1331608	hsa-miR-3607-3p	CLIP-seq
MIRT1331610	hsa-miR-3686	CLIP-seq
MIRT2322630	hsa-miR-369-3p	CLIP-seq
MIRT2322631	hsa-miR-374c	CLIP-seq
MIRT2322646	hsa-miR-3925-5p	CLIP-seq
MIRT2322647	hsa-miR-4422	CLIP-seq
MIRT2322648	hsa-miR-4477a	CLIP-seq
MIRT2322649	hsa-miR-4496	CLIP-seq
MIRT2322650	hsa-miR-4497	CLIP-seq
MIRT2322651	hsa-miR-4662a-3p	CLIP-seq
MIRT2322652	hsa-miR-4711-5p	CLIP-seq
MIRT2322653	hsa-miR-4712-5p	CLIP-seq
MIRT2322654	hsa-miR-4738-3p	CLIP-seq
MIRT2322655	hsa-miR-4747-5p	CLIP-seq
MIRT2322656	hsa-miR-4797-3p	CLIP-seq
MIRT2322657	hsa-miR-4803	CLIP-seq
MIRT2322658	hsa-miR-493	CLIP-seq
MIRT2322659	hsa-miR-498	CLIP-seq
MIRT2322660	hsa-miR-517b	CLIP-seq
MIRT2322661	hsa-miR-524-3p	CLIP-seq
MIRT2322662	hsa-miR-525-3p	CLIP-seq
MIRT1331614	hsa-miR-548aa	CLIP-seq
MIRT2322663	hsa-miR-548c-3p	CLIP-seq
MIRT1331617	hsa-miR-629	CLIP-seq
MIRT2322632	hsa-miR-655	CLIP-seq
MIRT2322664	hsa-miR-720	CLIP-seq
MIRT2322665	hsa-miR-770-5p	CLIP-seq
MIRT2322666	hsa-miR-936	CLIP-seq
MIRT2322633	hsa-miR-103a	CLIP-seq
MIRT2322635	hsa-miR-107	CLIP-seq
MIRT2322638	hsa-miR-149	CLIP-seq
MIRT1331598	hsa-miR-216b	CLIP-seq
MIRT2394135	hsa-miR-23a	CLIP-seq
MIRT2394136	hsa-miR-23b	CLIP-seq
MIRT2394137	hsa-miR-23c	CLIP-seq
MIRT2322630	hsa-miR-369-3p	CLIP-seq
MIRT2322649	hsa-miR-4496	CLIP-seq
MIRT2322650	hsa-miR-4497	CLIP-seq
MIRT1331601	hsa-miR-4635	CLIP-seq
MIRT2322655	hsa-miR-4747-5p	CLIP-seq
MIRT2098027	hsa-miR-488	CLIP-seq
MIRT2322660	hsa-miR-517b	CLIP-seq
MIRT2098028	hsa-miR-561	CLIP-seq
MIRT2322664	hsa-miR-720	CLIP-seq
MIRT2440063	hsa-miR-1256	CLIP-seq
MIRT2440064	hsa-miR-199a-5p	CLIP-seq
MIRT2440065	hsa-miR-199b-5p	CLIP-seq
MIRT2440066	hsa-miR-2116	CLIP-seq
MIRT1331607	hsa-miR-329	CLIP-seq
MIRT1331609	hsa-miR-362-3p	CLIP-seq
MIRT2440067	hsa-miR-3662	CLIP-seq
MIRT1331611	hsa-miR-3941	CLIP-seq
MIRT2440068	hsa-miR-4255	CLIP-seq
MIRT2440069	hsa-miR-4642	CLIP-seq
MIRT1331612	hsa-miR-466	CLIP-seq
MIRT1331613	hsa-miR-4672	CLIP-seq
MIRT2440070	hsa-miR-4677-5p	CLIP-seq
MIRT1331615	hsa-miR-603	CLIP-seq
MIRT2440063	hsa-miR-1256	CLIP-seq
MIRT2440064	hsa-miR-199a-5p	CLIP-seq
MIRT2440065	hsa-miR-199b-5p	CLIP-seq
MIRT2440066	hsa-miR-2116	CLIP-seq
MIRT2618742	hsa-miR-216a	CLIP-seq
MIRT2618743	hsa-miR-3146	CLIP-seq
MIRT1331607	hsa-miR-329	CLIP-seq
MIRT2618744	hsa-miR-3613-3p	CLIP-seq
MIRT1331609	hsa-miR-362-3p	CLIP-seq
MIRT2618745	hsa-miR-371-5p	CLIP-seq
MIRT2618746	hsa-miR-371b-5p	CLIP-seq
MIRT1331611	hsa-miR-3941	CLIP-seq
MIRT2440068	hsa-miR-4255	CLIP-seq
MIRT2618747	hsa-miR-4517	CLIP-seq
MIRT2440069	hsa-miR-4642	CLIP-seq
MIRT1331612	hsa-miR-466	CLIP-seq
MIRT1331613	hsa-miR-4672	CLIP-seq
MIRT2440070	hsa-miR-4677-5p	CLIP-seq
MIRT2322656	hsa-miR-4797-3p	CLIP-seq
MIRT2618748	hsa-miR-4799-5p	CLIP-seq
MIRT2618749	hsa-miR-548a-5p	CLIP-seq
MIRT2618750	hsa-miR-548ab	CLIP-seq
MIRT2618751	hsa-miR-548ak	CLIP-seq
MIRT2618752	hsa-miR-548b-5p	CLIP-seq
MIRT2322663	hsa-miR-548c-3p	CLIP-seq
MIRT2618753	hsa-miR-548c-5p	CLIP-seq
MIRT2618754	hsa-miR-548d-5p	CLIP-seq
MIRT2618755	hsa-miR-548h	CLIP-seq
MIRT2618756	hsa-miR-548i	CLIP-seq
MIRT2618757	hsa-miR-548j	CLIP-seq
MIRT2618758	hsa-miR-548k	CLIP-seq
MIRT2618759	hsa-miR-548l	CLIP-seq
MIRT2618760	hsa-miR-548w	CLIP-seq
MIRT2618761	hsa-miR-548y	CLIP-seq
MIRT2618762	hsa-miR-559	CLIP-seq
MIRT1331615	hsa-miR-603	CLIP-seq
MIRT2618763	hsa-miR-646	CLIP-seq
MIRT2618764	hsa-miR-891b	CLIP-seq
MIRT2690305	hsa-miR-1245b-3p	CLIP-seq
MIRT2440063	hsa-miR-1256	CLIP-seq
MIRT2440064	hsa-miR-199a-5p	CLIP-seq
MIRT2440065	hsa-miR-199b-5p	CLIP-seq
MIRT2690306	hsa-miR-203	CLIP-seq
MIRT2440066	hsa-miR-2116	CLIP-seq
MIRT2618742	hsa-miR-216a	CLIP-seq
MIRT1331598	hsa-miR-216b	CLIP-seq
MIRT2618743	hsa-miR-3146	CLIP-seq
MIRT1331607	hsa-miR-329	CLIP-seq
MIRT2618744	hsa-miR-3613-3p	CLIP-seq
MIRT2690307	hsa-miR-361-5p	CLIP-seq
MIRT1331609	hsa-miR-362-3p	CLIP-seq
MIRT2690308	hsa-miR-3646	CLIP-seq
MIRT2618745	hsa-miR-371-5p	CLIP-seq
MIRT2618746	hsa-miR-371b-5p	CLIP-seq
MIRT1331611	hsa-miR-3941	CLIP-seq
MIRT2440068	hsa-miR-4255	CLIP-seq
MIRT2690309	hsa-miR-4280	CLIP-seq
MIRT2618747	hsa-miR-4517	CLIP-seq
MIRT2690310	hsa-miR-4539	CLIP-seq
MIRT1331601	hsa-miR-4635	CLIP-seq
MIRT2440069	hsa-miR-4642	CLIP-seq
MIRT1331612	hsa-miR-466	CLIP-seq
MIRT1331613	hsa-miR-4672	CLIP-seq
MIRT2440070	hsa-miR-4677-5p	CLIP-seq
MIRT2690311	hsa-miR-4719	CLIP-seq
MIRT2322656	hsa-miR-4797-3p	CLIP-seq
MIRT2618748	hsa-miR-4799-5p	CLIP-seq
MIRT2618749	hsa-miR-548a-5p	CLIP-seq
MIRT2618750	hsa-miR-548ab	CLIP-seq
MIRT2618751	hsa-miR-548ak	CLIP-seq
MIRT2618752	hsa-miR-548b-5p	CLIP-seq
MIRT2322663	hsa-miR-548c-3p	CLIP-seq
MIRT2618753	hsa-miR-548c-5p	CLIP-seq
MIRT2618754	hsa-miR-548d-5p	CLIP-seq
MIRT2618755	hsa-miR-548h	CLIP-seq
MIRT2618756	hsa-miR-548i	CLIP-seq
MIRT2618757	hsa-miR-548j	CLIP-seq
MIRT2618758	hsa-miR-548k	CLIP-seq
MIRT2618759	hsa-miR-548l	CLIP-seq
MIRT2618760	hsa-miR-548w	CLIP-seq
MIRT2618761	hsa-miR-548y	CLIP-seq
MIRT2618762	hsa-miR-559	CLIP-seq
MIRT1331615	hsa-miR-603	CLIP-seq
MIRT2690312	hsa-miR-624	CLIP-seq
MIRT2618763	hsa-miR-646	CLIP-seq
MIRT2618764	hsa-miR-891b	CLIP-seq

Show/Hide all(58)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002091	Process	Negative regulation of receptor internalization	IMP	25893292
GO:0005109	Function	Frizzled binding	IPI	18256285
GO:0005137	Function	Interleukin-5 receptor binding	ISS	11498591
GO:0005515	Function	Protein binding	IPI	12842047, 18256285, 18832467, 22660413, 24722188, 25122212, 25416956, 25893292, 25910212, 26787460, 27107012, 27386966, 29892012, 31515488, 32296183, 32814053
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	IDA	27386966
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005634	Component	Nucleus	NAS	11179419
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	18256285
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	NAS	9391086
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	18256285, 25893292, 27386966
GO:0005895	Component	Interleukin-5 receptor complex	ISS	11498591
GO:0005912	Component	Adherens junction	NAS	11179419
GO:0005925	Component	Focal adhesion	IEA
GO:0006612	Process	Protein targeting to membrane	NAS	10230395
GO:0006930	Process	Substrate-dependent cell migration, cell extension	NAS	12037664
GO:0007268	Process	Chemical synaptic transmission	NAS	9883737
GO:0007346	Process	Regulation of mitotic cell cycle	IMP	26539120
GO:0008093	Function	Cytoskeletal anchor activity	NAS	9391086
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	26539120
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IMP	25893292
GO:0010862	Process	Positive regulation of pathway-restricted SMAD protein phosphorylation	IBA	21873635
GO:0010862	Process	Positive regulation of pathway-restricted SMAD protein phosphorylation	IMP	25893292
GO:0016020	Component	Membrane	NAS	9391086
GO:0030036	Process	Actin cytoskeleton organization	NAS	12037664
GO:0030307	Process	Positive regulation of cell growth	IMP	26539120
GO:0030335	Process	Positive regulation of cell migration	IMP	25893292, 26539120
GO:0030511	Process	Positive regulation of transforming growth factor beta receptor signaling pathway	IBA	21873635
GO:0030511	Process	Positive regulation of transforming growth factor beta receptor signaling pathway	IMP	25893292
GO:0031965	Component	Nuclear membrane	IDA
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	25893292
GO:0035556	Process	Intracellular signal transduction	NAS	9391086
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0042327	Process	Positive regulation of phosphorylation	IDA	18256285
GO:0042470	Component	Melanosome	IEA
GO:0042802	Function	Identical protein binding	IPI	22673509, 32296183
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0045121	Component	Membrane raft	IDA	25893292
GO:0045202	Component	Synapse	IEA
GO:0045545	Function	Syndecan binding	IBA	21873635
GO:0045545	Function	Syndecan binding	IPI	18256285, 22660413
GO:0045545	Function	Syndecan binding	NAS	9391086
GO:0046330	Process	Positive regulation of JNK cascade	IC	18256285
GO:0046982	Function	Protein heterodimerization activity	IPI	11152476
GO:0047485	Function	Protein N-terminus binding	IPI	15371445
GO:0048013	Process	Ephrin receptor signaling pathway	TAS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 20458337, 21362503, 23533145
GO:0070062	Component	Extracellular exosome	IDA	21082674
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:1903543	Process	Positive regulation of exosomal secretion	IMP	22660413
GO:1903553	Process	Positive regulation of extracellular exosome assembly	IMP	22660413
GO:1903561	Component	Extracellular vesicle	HDA	24769233

MIM	HGNC	e!Ensembl
602217	10662	ENSG00000137575

Protein

UniProt ID

O00560

Protein name

Syntenin-1 (Melanoma differentiation-associated protein 9) (MDA-9) (Pro-TGF-alpha cytoplasmic domain-interacting protein 18) (TACIP18) (Scaffold protein Pbp1) (Syndecan-binding protein 1)

Protein function

Multifunctional adapter protein involved in diverse array of functions including trafficking of transmembrane proteins, neuro and immunomodulation, exosome biogenesis, and tumorigenesis (PubMed:26291527). Positively regulates TGFB1-mediated SMAD

PDB

1N99 , 1NTE , 1OBX , 1OBY , 1OBZ , 1R6J , 1V1T , 1W9E , 1W9O , 1W9Q , 1YBO , 4Z33 , 6R9H , 6RLC , 7FSG , 7FSH , 7FSI , 7FSJ , 7FSK , 7FSL , 7FSM , 7FSN , 7FSO , 7FSP , 7FSQ , 7FSR , 7FSS , 7FST , 7FSU , 7FSV , 7FSW , 7FSX , 7FSY , 7FSZ , 7FT0 , 7FT1 , 7FT2 , 7FT3 , 7FT4 , 7FT5 , 7FT6 , 7FT7 , 7FT8 , 7FT9 , 7FTA , 7FTB , 7FTC , 7FTD , 8AAI , 8AAK , 8AAO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00595	PDZ	114 → 191	PDZ domain	Domain
PF00595	PDZ	198 → 270	PDZ domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in lung cancers, including adenocarcinoma, squamous cell carcinoma and small-cell carcinoma (at protein level) (PubMed:25893292). Widely expressed. Expressed in fetal kidney, liver, lung and brain. In adult highest expression

Sequence

MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLS
LNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKD
QDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQ
AFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICE
INGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV

Sequence length

298

Interactions

View interactions

	Reactome
			Ephrin signaling Neurofascin interactions Neutrophil degranulation

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Arthritis	Degenerative polyarthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	18784066

Show/Hide Text Mining Associations (43)

Disease Name	Relationship Type	References
Associations from Text Mining
Arthritis Rheumatoid	Associate	37415981
Asthma	Stimulate	40634444
Breast Neoplasms	Stimulate	32595209
Breast Neoplasms	Associate	36834839
Carcinoma	Associate	36870688
Carcinoma Basal Cell	Associate	23873690
Carcinoma Non Small Cell Lung	Associate	32901857
Carcinoma Pancreatic Ductal	Stimulate	35241737
Carcinoma Small Cell	Associate	24722482
Carcinoma Squamous Cell	Associate	37562257
Cell Transformation Neoplastic	Associate	36209503
Colorectal Neoplasms	Associate	32595209
COVID 19	Associate	34137173
Depressive Disorder Major	Associate	37415981
Diabetes Mellitus	Associate	33909846
Glioblastoma	Associate	30118375
Glioma	Associate	29760085, 30118375
Glioma	Stimulate	32595209
Glioma of Brain Familial	Stimulate	22938480
Legionnaires' Disease	Associate	31525518
Liposarcoma	Associate	36870688
Lung Neoplasms	Associate	27802291, 32106836, 34137173, 35136055
Lymphatic Metastasis	Associate	25480418
Lymphatic Metastasis	Stimulate	27811365
Melanoma	Associate	20228839, 23056502
Melanoma	Stimulate	32595209
Melanoma Cutaneous Malignant	Associate	37562257
Neoplasm Metastasis	Associate	20228839, 23873690, 24722482, 25480418, 36834839, 37922327
Neoplasm Metastasis	Stimulate	31406249, 32106836
Neoplasms	Associate	20228839, 21828040, 23873690, 24722482, 29109268, 35067864, 35136055, 35241737, 36834839, 37922327
Neoplasms	Stimulate	32106836, 32595209
Neuroblastoma	Associate	31406249
Neuroendocrine Tumors	Associate	27802291
Neutrophil Immunodeficiency Syndrome	Associate	35197088
Pheochromocytoma	Associate	33828526
Pigmentation Disorders	Associate	32626944
Prostatic Neoplasms	Inhibit	21372825
Prostatic Neoplasms	Associate	34445387, 37922327
Prostatitis	Associate	34445387
Small Cell Lung Carcinoma	Associate	24722482
Squamous Cell Carcinoma of Head and Neck	Associate	27811365
Stomach Neoplasms	Associate	20228839
von Hippel Lindau Disease	Associate	33828526

SDCBP (syndecan binding protein)