Gene Gene information from NCBI Gene database.
Entrez ID 6386
Gene name Syndecan binding protein
Gene symbol SDCBP
Synonyms (NCBI Gene)
MDA-9MDA9SDCBP1ST1SYCLTACIP18
Chromosome 8
Chromosome location 8q12.1
Summary The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of tran
miRNA miRNA information provided by mirtarbase database.
225
miRTarBase ID miRNA Experiments Reference
MIRT001503 hsa-miR-155-5p pSILAC 18668040
MIRT001503 hsa-miR-155-5p Reporter assay;Other 20584899
MIRT001503 hsa-miR-155-5p Proteomics 18668040
MIRT027019 hsa-miR-103a-3p Sequencing 20371350
MIRT028447 hsa-miR-30a-5p Proteomics 18668040
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
74
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 15371445
GO:0002091 Process Negative regulation of receptor internalization IMP 25893292
GO:0005109 Function Frizzled binding IPI 18256285
GO:0005137 Function Interleukin-5 receptor binding IEA
GO:0005137 Function Interleukin-5 receptor binding ISS 11498591
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602217 10662 ENSG00000137575
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O00560
Protein name Syntenin-1 (Melanoma differentiation-associated protein 9) (MDA-9) (Pro-TGF-alpha cytoplasmic domain-interacting protein 18) (TACIP18) (Scaffold protein Pbp1) (Syndecan-binding protein 1)
Protein function Multifunctional adapter protein involved in diverse array of functions including trafficking of transmembrane proteins, neuro and immunomodulation, exosome biogenesis, and tumorigenesis (PubMed:26291527). Positively regulates TGFB1-mediated SMAD
PDB 1N99 , 1NTE , 1OBX , 1OBY , 1OBZ , 1R6J , 1V1T , 1W9E , 1W9O , 1W9Q , 1YBO , 4Z33 , 6R9H , 6RLC , 7FSG , 7FSH , 7FSI , 7FSJ , 7FSK , 7FSL , 7FSM , 7FSN , 7FSO , 7FSP , 7FSQ , 7FSR , 7FSS , 7FST , 7FSU , 7FSV , 7FSW , 7FSX , 7FSY , 7FSZ , 7FT0 , 7FT1 , 7FT2 , 7FT3 , 7FT4 , 7FT5 , 7FT6 , 7FT7 , 7FT8 , 7FT9 , 7FTA , 7FTB , 7FTC , 7FTD , 8AAI , 8AAK , 8AAO
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00595 PDZ 114 191 PDZ domain Domain
PF00595 PDZ 198 270 PDZ domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in lung cancers, including adenocarcinoma, squamous cell carcinoma and small-cell carcinoma (at protein level) (PubMed:25893292). Widely expressed. Expressed in fetal kidney, liver, lung and brain. In adult highest expression
Sequence
MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLS
LNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKD
QDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQ
AFGEKITMTIR
DRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICE
INGQNVIGLKDSQIADILSTSGTVVTITIM
PAFIFEHIIKRMAPSIMKSLMDHTIPEV
Sequence length 298
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Ephrin signaling
Neurofascin interactions
Neutrophil degranulation