Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6385
Gene name Gene Name - the full gene name approved by the HGNC.
Syndecan 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SDC4
Synonyms (NCBI Gene) Gene synonyms aliases
SYND4
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q13.12
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan that functions as a receptor in intracellular signaling. The encoded protein is found as a homodimer and is a member of the syndecan proteoglycan family. This gene i
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT002795 hsa-miR-1-3p Microarray 15685193
MIRT022356 hsa-miR-124-3p Microarray 18668037
MIRT002795 hsa-miR-1-3p Proteomics;Microarray 18668037
MIRT002795 hsa-miR-1-3p Microarray 15685193
MIRT438457 hsa-miR-18a-5p Luciferase reporter assay, qRT-PCR 25089138
Transcription factors
Transcription factor Regulation Reference
POU2F1 Unknown 19212692
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001523 Process Retinoid metabolic process TAS
GO:0001657 Process Ureteric bud development IEA
GO:0001843 Process Neural tube closure IEA
GO:0001968 Function Fibronectin binding IEA
GO:0005080 Function Protein kinase C binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600017 10661 ENSG00000124145
Protein
UniProt ID P31431
Protein name Syndecan-4 (SYND4) (Amphiglycan) (Ryudocan core protein)
Protein function Cell surface proteoglycan which regulates exosome biogenesis in concert with SDCBP and PDCD6IP (PubMed:22660413).
PDB 1EJP , 1EJQ , 1OBY , 1YBO , 8BLV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01034 Syndecan 139 196 Syndecan domain Family
Tissue specificity TISSUE SPECIFICITY: Detected in fibroblasts (at protein level) (PubMed:1500433, PubMed:36213313). Also expressed in epithelial cells (PubMed:1500433). {ECO:0000269|PubMed:1500433, ECO:0000269|PubMed:36213313}.
Sequence
MAPARLFALLLFFVGGVAESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFEL
SGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVE
ESEDVSNKVSMSSTVQGSNIFERTEVLAALIVGGIVGILFAVFLILLLMYRMKKKDEGSY
DLGKKPIYKKAPTNEF
YA
Sequence length 198
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  ECM-receptor interaction
Cell adhesion molecules
Cytoskeleton in muscle cells
Proteoglycans in cancer
Fluid shear stress and atherosclerosis
  A tetrasaccharide linker sequence is required for GAG synthesis
HS-GAG biosynthesis
HS-GAG degradation
Cell surface interactions at the vascular wall
Syndecan interactions
Defective B4GALT7 causes EDS, progeroid type
Defective B3GAT3 causes JDSSDHD
Defective EXT2 causes exostoses 2
Defective EXT1 causes exostoses 1, TRPS2 and CHDS
Defective B3GALT6 causes EDSP2 and SEMDJL1
Retinoid metabolism and transport
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Lung carcinoma Non-Small Cell Lung Carcinoma rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355
View all (44 more)
22919003
Unknown
Disease term Disease name Evidence References Source
Psoriasis Psoriasis GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 28971587
Alzheimer Disease Stimulate 30718543
Ascites Associate 33721368
Asthma Associate 22268118
Atrial Fibrillation Associate 36341343
Breast Neoplasms Associate 11786412, 21430259, 22513363, 25361632, 36152082, 36335555, 39938698
Carcinoma Hepatocellular Associate 17259344, 24751902, 28993096
Carcinoma Non Small Cell Lung Associate 32503508
Cartilage Diseases Associate 31455087
Colorectal Neoplasms Associate 12055189