Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6383
Gene name	Syndecan 2
Gene symbol	SDC2
Synonyms (NCBI Gene)	CD362HSPGHSPG1SYND2
Chromosome	8
Chromosome location	8q22.1
Summary	The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. The syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are req

205

Show/Hide all (205)

miRTarBase ID	miRNA	Experiments	Reference
MIRT468760	hsa-miR-495-3p	PAR-CLIP	23592263
MIRT468759	hsa-miR-5688	PAR-CLIP	23592263
MIRT468758	hsa-miR-7-1-3p	PAR-CLIP	23592263
MIRT468757	hsa-miR-7-2-3p	PAR-CLIP	23592263
MIRT468756	hsa-miR-3125	PAR-CLIP	23592263
MIRT468755	hsa-miR-3916	PAR-CLIP	23592263
MIRT468754	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT468753	hsa-miR-577	PAR-CLIP	23592263
MIRT468752	hsa-miR-4476	PAR-CLIP	23592263
MIRT468751	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT468750	hsa-miR-4436b-3p	PAR-CLIP	23592263
MIRT468749	hsa-miR-4632-5p	PAR-CLIP	23592263
MIRT468748	hsa-miR-6735-5p	PAR-CLIP	23592263
MIRT468747	hsa-miR-6879-5p	PAR-CLIP	23592263
MIRT468746	hsa-miR-7843-5p	PAR-CLIP	23592263
MIRT468745	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT468744	hsa-miR-3179	PAR-CLIP	23592263
MIRT468743	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT468742	hsa-miR-4784	PAR-CLIP	23592263
MIRT468741	hsa-miR-3616-3p	PAR-CLIP	23592263
MIRT468740	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT468739	hsa-miR-3202	PAR-CLIP	23592263
MIRT468760	hsa-miR-495-3p	PAR-CLIP	23592263
MIRT468759	hsa-miR-5688	PAR-CLIP	23592263
MIRT468758	hsa-miR-7-1-3p	PAR-CLIP	23592263
MIRT468757	hsa-miR-7-2-3p	PAR-CLIP	23592263
MIRT468756	hsa-miR-3125	PAR-CLIP	23592263
MIRT468755	hsa-miR-3916	PAR-CLIP	23592263
MIRT468754	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT468753	hsa-miR-577	PAR-CLIP	23592263
MIRT468752	hsa-miR-4476	PAR-CLIP	23592263
MIRT468751	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT468750	hsa-miR-4436b-3p	PAR-CLIP	23592263
MIRT468749	hsa-miR-4632-5p	PAR-CLIP	23592263
MIRT468748	hsa-miR-6735-5p	PAR-CLIP	23592263
MIRT468747	hsa-miR-6879-5p	PAR-CLIP	23592263
MIRT468746	hsa-miR-7843-5p	PAR-CLIP	23592263
MIRT468745	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT468744	hsa-miR-3179	PAR-CLIP	23592263
MIRT468743	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT468742	hsa-miR-4784	PAR-CLIP	23592263
MIRT468741	hsa-miR-3616-3p	PAR-CLIP	23592263
MIRT468740	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT468739	hsa-miR-3202	PAR-CLIP	23592263
MIRT1331299	hsa-miR-1271	CLIP-seq
MIRT1331300	hsa-miR-182	CLIP-seq
MIRT1331301	hsa-miR-3190	CLIP-seq
MIRT1331302	hsa-miR-3200-5p	CLIP-seq
MIRT1331303	hsa-miR-331-3p	CLIP-seq
MIRT1331304	hsa-miR-3622b-5p	CLIP-seq
MIRT1331305	hsa-miR-3646	CLIP-seq
MIRT1331306	hsa-miR-3647-3p	CLIP-seq
MIRT1331307	hsa-miR-3941	CLIP-seq
MIRT1331308	hsa-miR-4251	CLIP-seq
MIRT1331309	hsa-miR-4257	CLIP-seq
MIRT1331310	hsa-miR-4329	CLIP-seq
MIRT1331311	hsa-miR-4642	CLIP-seq
MIRT1331312	hsa-miR-4643	CLIP-seq
MIRT1331313	hsa-miR-466	CLIP-seq
MIRT1331314	hsa-miR-4670-3p	CLIP-seq
MIRT1331315	hsa-miR-4672	CLIP-seq
MIRT1331316	hsa-miR-4704-5p	CLIP-seq
MIRT1331317	hsa-miR-4719	CLIP-seq
MIRT1331318	hsa-miR-4728-3p	CLIP-seq
MIRT1331319	hsa-miR-4775	CLIP-seq
MIRT1331320	hsa-miR-4789-3p	CLIP-seq
MIRT1331321	hsa-miR-4789-5p	CLIP-seq
MIRT1331322	hsa-miR-494	CLIP-seq
MIRT1331323	hsa-miR-499a-5p	CLIP-seq
MIRT1331324	hsa-miR-561	CLIP-seq
MIRT1331325	hsa-miR-590-3p	CLIP-seq
MIRT1331326	hsa-miR-605	CLIP-seq
MIRT1331327	hsa-miR-628-5p	CLIP-seq
MIRT1331328	hsa-miR-642b	CLIP-seq
MIRT1331329	hsa-miR-885-3p	CLIP-seq
MIRT1331330	hsa-miR-96	CLIP-seq
MIRT1553262	hsa-miR-3148	CLIP-seq
MIRT1553263	hsa-miR-3149	CLIP-seq
MIRT1553264	hsa-miR-4496	CLIP-seq
MIRT1331316	hsa-miR-4704-5p	CLIP-seq
MIRT1553265	hsa-miR-4762-5p	CLIP-seq
MIRT1331319	hsa-miR-4775	CLIP-seq
MIRT1331321	hsa-miR-4789-5p	CLIP-seq
MIRT1553266	hsa-miR-4796-3p	CLIP-seq
MIRT1331325	hsa-miR-590-3p	CLIP-seq
MIRT1553267	hsa-miR-627	CLIP-seq
MIRT1331319	hsa-miR-4775	CLIP-seq
MIRT2322548	hsa-miR-103a	CLIP-seq
MIRT2322549	hsa-miR-107	CLIP-seq
MIRT2322550	hsa-miR-1184	CLIP-seq
MIRT2322551	hsa-miR-1205	CLIP-seq
MIRT2322552	hsa-miR-1283	CLIP-seq
MIRT2322553	hsa-miR-25	CLIP-seq
MIRT1553262	hsa-miR-3148	CLIP-seq
MIRT1553263	hsa-miR-3149	CLIP-seq
MIRT2322554	hsa-miR-3158-5p	CLIP-seq
MIRT2322555	hsa-miR-32	CLIP-seq
MIRT1331302	hsa-miR-3200-5p	CLIP-seq
MIRT2322556	hsa-miR-363	CLIP-seq
MIRT1331305	hsa-miR-3646	CLIP-seq
MIRT2322557	hsa-miR-367	CLIP-seq
MIRT2322558	hsa-miR-4307	CLIP-seq
MIRT1553264	hsa-miR-4496	CLIP-seq
MIRT2322559	hsa-miR-4666-3p	CLIP-seq
MIRT2322560	hsa-miR-4680-3p	CLIP-seq
MIRT1331317	hsa-miR-4719	CLIP-seq
MIRT2322561	hsa-miR-4781-3p	CLIP-seq
MIRT1331321	hsa-miR-4789-5p	CLIP-seq
MIRT1331322	hsa-miR-494	CLIP-seq
MIRT1553267	hsa-miR-627	CLIP-seq
MIRT1331328	hsa-miR-642b	CLIP-seq
MIRT2322562	hsa-miR-659	CLIP-seq
MIRT2322563	hsa-miR-767-5p	CLIP-seq
MIRT2322564	hsa-miR-891b	CLIP-seq
MIRT2322565	hsa-miR-9	CLIP-seq
MIRT2322566	hsa-miR-92a	CLIP-seq
MIRT2322567	hsa-miR-92b	CLIP-seq
MIRT2322552	hsa-miR-1283	CLIP-seq
MIRT2394131	hsa-miR-199a-3p	CLIP-seq
MIRT2394132	hsa-miR-199b-3p	CLIP-seq
MIRT2394133	hsa-miR-3129-5p	CLIP-seq
MIRT2394134	hsa-miR-936	CLIP-seq
MIRT2322552	hsa-miR-1283	CLIP-seq
MIRT2432940	hsa-miR-296-3p	CLIP-seq
MIRT1331305	hsa-miR-3646	CLIP-seq
MIRT1331306	hsa-miR-3647-3p	CLIP-seq
MIRT2432941	hsa-miR-3910	CLIP-seq
MIRT1331316	hsa-miR-4704-5p	CLIP-seq
MIRT1331317	hsa-miR-4719	CLIP-seq
MIRT1331321	hsa-miR-4789-5p	CLIP-seq
MIRT1331322	hsa-miR-494	CLIP-seq
MIRT2432942	hsa-miR-548an	CLIP-seq
MIRT1553267	hsa-miR-627	CLIP-seq
MIRT1331328	hsa-miR-642b	CLIP-seq
MIRT2440060	hsa-miR-3156-5p	CLIP-seq
MIRT1331305	hsa-miR-3646	CLIP-seq
MIRT1553264	hsa-miR-4496	CLIP-seq
MIRT1331317	hsa-miR-4719	CLIP-seq
MIRT1331322	hsa-miR-494	CLIP-seq
MIRT1553267	hsa-miR-627	CLIP-seq
MIRT1331328	hsa-miR-642b	CLIP-seq
MIRT2618679	hsa-miR-1245	CLIP-seq
MIRT2322552	hsa-miR-1283	CLIP-seq
MIRT2618680	hsa-miR-1321	CLIP-seq
MIRT2618681	hsa-miR-2277-3p	CLIP-seq
MIRT2432940	hsa-miR-296-3p	CLIP-seq
MIRT2618682	hsa-miR-300	CLIP-seq
MIRT2618683	hsa-miR-3117-5p	CLIP-seq
MIRT2618684	hsa-miR-3121-3p	CLIP-seq
MIRT1553262	hsa-miR-3148	CLIP-seq
MIRT1553263	hsa-miR-3149	CLIP-seq
MIRT2618685	hsa-miR-3154	CLIP-seq
MIRT1331301	hsa-miR-3190	CLIP-seq
MIRT1331305	hsa-miR-3646	CLIP-seq
MIRT2618686	hsa-miR-381	CLIP-seq
MIRT2432941	hsa-miR-3910	CLIP-seq
MIRT2618687	hsa-miR-3976	CLIP-seq
MIRT2618688	hsa-miR-4282	CLIP-seq
MIRT2618689	hsa-miR-4477b	CLIP-seq
MIRT1553264	hsa-miR-4496	CLIP-seq
MIRT2322559	hsa-miR-4666-3p	CLIP-seq
MIRT1331314	hsa-miR-4670-3p	CLIP-seq
MIRT2618690	hsa-miR-4695-3p	CLIP-seq
MIRT1331317	hsa-miR-4719	CLIP-seq
MIRT2618691	hsa-miR-4728-5p	CLIP-seq
MIRT2618692	hsa-miR-4739	CLIP-seq
MIRT2618693	hsa-miR-4756-5p	CLIP-seq
MIRT1331321	hsa-miR-4789-5p	CLIP-seq
MIRT1553266	hsa-miR-4796-3p	CLIP-seq
MIRT2618694	hsa-miR-4803	CLIP-seq
MIRT1331322	hsa-miR-494	CLIP-seq
MIRT2618695	hsa-miR-520d-5p	CLIP-seq
MIRT2618696	hsa-miR-520g	CLIP-seq
MIRT2618697	hsa-miR-520h	CLIP-seq
MIRT2618698	hsa-miR-524-5p	CLIP-seq
MIRT2432942	hsa-miR-548an	CLIP-seq
MIRT2618699	hsa-miR-548c-3p	CLIP-seq
MIRT2618700	hsa-miR-548n	CLIP-seq
MIRT2618701	hsa-miR-548t	CLIP-seq
MIRT1331324	hsa-miR-561	CLIP-seq
MIRT1553267	hsa-miR-627	CLIP-seq
MIRT1331328	hsa-miR-642b	CLIP-seq
MIRT2322562	hsa-miR-659	CLIP-seq
MIRT2322552	hsa-miR-1283	CLIP-seq
MIRT2618680	hsa-miR-1321	CLIP-seq
MIRT2618681	hsa-miR-2277-3p	CLIP-seq
MIRT2432940	hsa-miR-296-3p	CLIP-seq
MIRT1553262	hsa-miR-3148	CLIP-seq
MIRT1553263	hsa-miR-3149	CLIP-seq
MIRT2618685	hsa-miR-3154	CLIP-seq
MIRT1331305	hsa-miR-3646	CLIP-seq
MIRT2432941	hsa-miR-3910	CLIP-seq
MIRT2618689	hsa-miR-4477b	CLIP-seq
MIRT1553264	hsa-miR-4496	CLIP-seq
MIRT1331317	hsa-miR-4719	CLIP-seq
MIRT2618692	hsa-miR-4739	CLIP-seq
MIRT2618693	hsa-miR-4756-5p	CLIP-seq
MIRT1331322	hsa-miR-494	CLIP-seq
MIRT2432942	hsa-miR-548an	CLIP-seq
MIRT2618700	hsa-miR-548n	CLIP-seq
MIRT2618701	hsa-miR-548t	CLIP-seq
MIRT1331324	hsa-miR-561	CLIP-seq
MIRT1553267	hsa-miR-627	CLIP-seq
MIRT1331328	hsa-miR-642b	CLIP-seq
MIRT2322562	hsa-miR-659	CLIP-seq

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	9660868, 11356864, 18093920, 22660413, 32296183, 32814053, 33961781
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0007399	Process	Nervous system development	IEA
GO:0009986	Component	Cell surface	IBA
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0030165	Function	PDZ domain binding	IPI	18256285
GO:0031012	Component	Extracellular matrix	HDA	27068509
GO:0042802	Function	Identical protein binding	IPI	18093920, 21988832
GO:0043202	Component	Lysosomal lumen	TAS
GO:0048813	Process	Dendrite morphogenesis	IBA
GO:0048814	Process	Regulation of dendrite morphogenesis	IEA
GO:0048814	Process	Regulation of dendrite morphogenesis	ISS

MIM	HGNC	e!Ensembl
142460	10659	ENSG00000169439

P34741

Protein name

Syndecan-2 (SYND2) (Fibroglycan) (Heparan sulfate proteoglycan core protein) (HSPG) (CD antigen CD362)

Protein function

Cell surface proteoglycan which regulates dendritic arbor morphogenesis.

PDB

6ITH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01034	Syndecan	138 → 199	Syndecan domain	Family

Sequence

MRRAWILLTLGLVACVSAESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGAD
EDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERK
MDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYD
LGERKPSSAAYQKAPTKEFYA

Sequence length

201

Interactions

View interactions

	KEGG		Reactome
	Cell adhesion molecules Cytoskeleton in muscle cells Malaria Proteoglycans in cancer Fluid shear stress and atherosclerosis		A tetrasaccharide linker sequence is required for GAG synthesis HS-GAG biosynthesis HS-GAG degradation Cell surface interactions at the vascular wall Syndecan interactions Defective B4GALT7 causes EDS, progeroid type Defective B3GAT3 causes JDSSDHD Defective EXT2 causes exostoses 2 Defective EXT1 causes exostoses 1, TRPS2 and CHDS Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) EPHB-mediated forward signaling Defective B3GALT6 causes EDSP2 and SEMDJL1 Post-translational protein phosphorylation Retinoid metabolism and transport

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT PALATE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT UPPER LIP	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLETE UNILATERAL CLEFT LIP	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DRY EYE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGREN SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (57)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	23327652, 34397867	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	30106131	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Associate	28058013, 28753106, 36203138	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Stimulate	29730903	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma Villous	Associate	29730903	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Associate	29225717	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arrest of spermatogenesis	Associate	39285301	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Associate	17545191	★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Associate	39285301	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	19383343, 23327652, 24357546, 25623282	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Associate	12055189, 31337828	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	12055189, 23747112, 24485021, 28700744, 28753106, 29225717, 29730903, 29945573, 30876480, 31089394, 31407497, 31707342, 33126908, 33393623, 33504902 View all (18 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Stimulate	23705906	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Associate	32111749	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Associate	24278138	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Associate	22745764, 23297089	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	35702951	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Associate	25935541	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Associate	32174066	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Associate	27693511	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Associate	24278138	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infections	Associate	27223085	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Associate	39285301	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	18032547	★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Associate	32174066	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Associate	31467338	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Associate	18032547	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	17035092	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Associate	24736615	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Associate	23867796	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Stimulate	24927672, 31707342	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	19696445	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Associate	35127947	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	16732320	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Invasiveness	Associate	24927672	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	22745764, 31707342, 34229299, 34397867, 36810912	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Stimulate	24927672	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	20930391, 22471946, 22745764, 23705906, 23747112, 24927672, 29225717, 31089394, 32793117, 34397867, 36181793, 36510988, 37419119, 37496999	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	34382948	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis Familial Spinal	Stimulate	37217626	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	22471946, 9802880	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillomavirus Infections	Associate	37358427	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Associate	35794640	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyposis Syndrome Hereditary Mixed 1	Associate	28753106	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyps	Associate	29225717, 29730903, 36203138	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precancerous Conditions	Associate	29730903, 37881109, 40307680	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	21317913, 34445387	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Dysplasia	Associate	29730903	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	35358652	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Intraepithelial Lesions	Associate	37410084	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	33178362, 37419119, 37496999	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Associate	33521130	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Associate	32793117	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Stimulate	25623282	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	37410084	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervicitis	Associate	27223085	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Associate	35426938	★★★★★ ★☆☆☆☆ Found in Text Mining only

SDC2 (syndecan 2)