Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	63826
Gene name	Serine racemase
Gene symbol	SRR
Synonyms (NCBI Gene)	ILV1ISO1
Chromosome	17
Chromosome location	17p13.3

Show/Hide all (63)

miRTarBase ID	miRNA	Experiments	Reference
MIRT731604	hsa-miR-193a-5p	Luciferase reporter assay	26913720
MIRT731604	hsa-miR-193a-5p	Luciferase reporter assay	26913720
MIRT731604	hsa-miR-193a-5p	Luciferase reporter assay	26913720
MIRT731604	hsa-miR-193a-5p	Luciferase reporter assay	26913720
MIRT731604	hsa-miR-193a-5p	Luciferase reporter assay	26913720
MIRT2116742	hsa-miR-3646	CLIP-seq
MIRT2339171	hsa-miR-561	CLIP-seq
MIRT2632951	hsa-miR-1207-5p	CLIP-seq
MIRT2632952	hsa-miR-1587	CLIP-seq
MIRT2632953	hsa-miR-2964a-5p	CLIP-seq
MIRT2632954	hsa-miR-3121-3p	CLIP-seq
MIRT2632955	hsa-miR-3155	CLIP-seq
MIRT2632956	hsa-miR-3155b	CLIP-seq
MIRT2632957	hsa-miR-3607-3p	CLIP-seq
MIRT2632958	hsa-miR-4265	CLIP-seq
MIRT2632959	hsa-miR-4273	CLIP-seq
MIRT2632960	hsa-miR-4282	CLIP-seq
MIRT2632961	hsa-miR-4296	CLIP-seq
MIRT2632962	hsa-miR-4322	CLIP-seq
MIRT2632963	hsa-miR-4330	CLIP-seq
MIRT2632964	hsa-miR-4417	CLIP-seq
MIRT2632965	hsa-miR-4436b-3p	CLIP-seq
MIRT2632966	hsa-miR-4502	CLIP-seq
MIRT2632967	hsa-miR-4674	CLIP-seq
MIRT2632968	hsa-miR-4677-5p	CLIP-seq
MIRT2632969	hsa-miR-4761-3p	CLIP-seq
MIRT2632970	hsa-miR-4762-3p	CLIP-seq
MIRT2632971	hsa-miR-4763-3p	CLIP-seq
MIRT2632972	hsa-miR-4775	CLIP-seq
MIRT2632973	hsa-miR-484	CLIP-seq
MIRT2632974	hsa-miR-511	CLIP-seq
MIRT2632975	hsa-miR-582-5p	CLIP-seq
MIRT2632976	hsa-miR-595	CLIP-seq
MIRT2632977	hsa-miR-600	CLIP-seq
MIRT2632978	hsa-miR-624	CLIP-seq
MIRT2632951	hsa-miR-1207-5p	CLIP-seq
MIRT2632952	hsa-miR-1587	CLIP-seq
MIRT2692015	hsa-miR-2355-3p	CLIP-seq
MIRT2632954	hsa-miR-3121-3p	CLIP-seq
MIRT2692016	hsa-miR-3140-3p	CLIP-seq
MIRT2632955	hsa-miR-3155	CLIP-seq
MIRT2632956	hsa-miR-3155b	CLIP-seq
MIRT2632957	hsa-miR-3607-3p	CLIP-seq
MIRT2632958	hsa-miR-4265	CLIP-seq
MIRT2632959	hsa-miR-4273	CLIP-seq
MIRT2632960	hsa-miR-4282	CLIP-seq
MIRT2632961	hsa-miR-4296	CLIP-seq
MIRT2632962	hsa-miR-4322	CLIP-seq
MIRT2632963	hsa-miR-4330	CLIP-seq
MIRT2632964	hsa-miR-4417	CLIP-seq
MIRT2632965	hsa-miR-4436b-3p	CLIP-seq
MIRT2692017	hsa-miR-4646-3p	CLIP-seq
MIRT2632967	hsa-miR-4674	CLIP-seq
MIRT2632968	hsa-miR-4677-5p	CLIP-seq
MIRT2632969	hsa-miR-4761-3p	CLIP-seq
MIRT2632971	hsa-miR-4763-3p	CLIP-seq
MIRT2632972	hsa-miR-4775	CLIP-seq
MIRT2632973	hsa-miR-484	CLIP-seq
MIRT2632975	hsa-miR-582-5p	CLIP-seq
MIRT2632976	hsa-miR-595	CLIP-seq
MIRT2632977	hsa-miR-600	CLIP-seq
MIRT2632978	hsa-miR-624	CLIP-seq
MIRT2692018	hsa-miR-676	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
FOS	Activation	15681805

Show/Hide all (54)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IBA
GO:0000287	Function	Magnesium ion binding	IDA	20106978
GO:0000287	Function	Magnesium ion binding	IEA
GO:0003824	Function	Catalytic activity	IEA
GO:0003941	Function	L-serine ammonia-lyase activity	IBA
GO:0003941	Function	L-serine ammonia-lyase activity	IDA	18812225
GO:0003941	Function	L-serine ammonia-lyase activity	IEA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	ISS
GO:0005515	Function	Protein binding	IPI	32296183, 33961781
GO:0005524	Function	ATP binding	IBA
GO:0005524	Function	ATP binding	IDA	20106978
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	16314870
GO:0005829	Component	Cytosol	TAS
GO:0006520	Process	Amino acid metabolic process	IEA
GO:0006563	Process	L-serine metabolic process	IDA	11054547, 15193426, 20106978
GO:0006563	Process	L-serine metabolic process	IEA
GO:0006563	Process	L-serine metabolic process	IEA
GO:0008721	Function	D-serine ammonia-lyase activity	IEA
GO:0009069	Process	Serine family amino acid metabolic process	ISS
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0016594	Function	Glycine binding	IEA
GO:0016594	Function	Glycine binding	ISS
GO:0016829	Function	Lyase activity	IEA
GO:0016853	Function	Isomerase activity	IEA
GO:0018114	Function	Threonine racemase activity	IEA
GO:0018114	Function	Threonine racemase activity	ISS
GO:0030165	Function	PDZ domain binding	IPI	16314870
GO:0030170	Function	Pyridoxal phosphate binding	IBA
GO:0030170	Function	Pyridoxal phosphate binding	IDA	20106978
GO:0030170	Function	Pyridoxal phosphate binding	IEA
GO:0030170	Function	Pyridoxal phosphate binding	ISS
GO:0030378	Function	Serine racemase activity	IBA
GO:0030378	Function	Serine racemase activity	IDA	11054547, 15193426, 20106978, 23391306, 29277459
GO:0030378	Function	Serine racemase activity	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEP	15681805
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	15681805, 32296183
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	20106978
GO:0042866	Process	Pyruvate biosynthetic process	IDA	18812225
GO:0043025	Component	Neuronal cell body	IDA	17880399
GO:0045177	Component	Apical part of cell	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0070178	Process	D-serine metabolic process	IDA	20106978
GO:0070178	Process	D-serine metabolic process	IEA
GO:0070179	Process	D-serine biosynthetic process	IBA
GO:0070179	Process	D-serine biosynthetic process	IDA	11054547, 15193426
GO:0070179	Process	D-serine biosynthetic process	IEA
GO:1901986	Process	Response to ketamine	IEA

MIM	HGNC	e!Ensembl
606477	14398	ENSG00000167720

Q9GZT4

Protein name

Serine racemase (EC 5.1.1.18) (D-serine ammonia-lyase) (D-serine dehydratase) (EC 4.3.1.18) (L-serine ammonia-lyase) (L-serine dehydratase) (EC 4.3.1.17)

Protein function

Catalyzes the synthesis of D-serine from L-serine (PubMed:20106978, PubMed:23391306, PubMed:29277459). D-serine is a key coagonist with glutamate at NMDA receptors. Has dehydratase activity towards both L-serine and D-serine (By similarity). {EC

PDB

3L6B , 3L6R , 5X2L , 6SLH , 6ZSP , 6ZUJ , 7NBC , 7NBD , 7NBF , 7NBG , 7NBH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00291	PALP	19 → 314	Pyridoxal-phosphate dependent enzyme	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in the cerebellum, hippocampus, dorsolateral prefrontal cortex, and in motor neurons and glial cells of the lumbar spinal cord (at protein level) (PubMed:17880399, PubMed:24138986). Increased in the dorsolateral prefrontal co

Sequence

MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGA
LNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQA
YGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDAL
VVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGV
KSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQT
VSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV

Sequence length

340

Interactions

View interactions

	KEGG		Reactome
	Glycine, serine and threonine metabolism D-Amino acid metabolism Metabolic pathways		Serine biosynthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Diabetes Gestational	Associate	22096510	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Associate	20174558, 37952608	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Associate	26168825, 35046895	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	37952608	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Associate	35996309	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	26913720	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Associate	31621607	★★★★★ ★☆☆☆☆ Found in Text Mining only

SRR (serine racemase)