Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6382
Gene name Gene Name - the full gene name approved by the HGNC.
Syndecan 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SDC1
Synonyms (NCBI Gene) Gene synonyms aliases
CD138, SDC, SYND1, syndecan
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p24.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. The syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are req
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT007072 hsa-miR-10b-5p Luciferase reporter assay 22573479
MIRT019998 hsa-miR-375 Microarray 20215506
MIRT021459 hsa-miR-9-5p Microarray 17612493
MIRT045538 hsa-miR-149-5p CLASH 23622248
MIRT052912 hsa-miR-143-3p Luciferase reporter assay, qRT-PCR, Western blot 24722758
Transcription factors
Transcription factor Regulation Reference
NFKB1 Activation 16132527
RELA Activation 16132527
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001523 Process Retinoid metabolic process TAS
GO:0001657 Process Ureteric bud development IEA
GO:0005515 Function Protein binding IPI 15292202, 18093920, 23395182, 32814053
GO:0005796 Component Golgi lumen TAS
GO:0005886 Component Plasma membrane TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
186355 10658 ENSG00000115884
Protein
UniProt ID P18827
Protein name Syndecan-1 (SYND1) (CD antigen CD138)
Protein function Cell surface proteoglycan that contains both heparan sulfate and chondroitin sulfate and that links the cytoskeleton to the interstitial matrix (By similarity). Regulates exosome biogenesis in concert with SDCBP and PDCD6IP (PubMed:22660413). Ab
PDB 4GVC , 4GVD , 6EJE
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01034 Syndecan 245 308 Syndecan domain Family
Tissue specificity TISSUE SPECIFICITY: Detected in placenta (at protein level) (PubMed:32337544). Detected in fibroblasts (at protein level) (PubMed:36213313). {ECO:0000269|PubMed:32337544, ECO:0000269|PubMed:36213313}.
Sequence
MRRAALWLWLCALALSLQPALPQIVATNLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQ
TPSTWKDTQLLTAIPTSPEPTGLEATAASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQE
ATPRPRETTQLPTTHLASTTTATTAQEPATSHPHRDMQPGHHETSTPAGPSQADLHTPHT
EDGGPSATERAAEDGASSQLPAAEGSGEQDFTFETSGENTAVVAVEPDRRNQSPVDQGAT
GASQGLLDRKEVLGGVIAGGLVGLIFAVCLVGFMLYRMKKKDEGSYSLEEPKQANGGAYQ
KPTKQEEF
YA
Sequence length 310
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  ECM-receptor interaction
Cell adhesion molecules
Cytoskeleton in muscle cells
Malaria
Proteoglycans in cancer
Fluid shear stress and atherosclerosis
  A tetrasaccharide linker sequence is required for GAG synthesis
HS-GAG biosynthesis
HS-GAG degradation
Cell surface interactions at the vascular wall
Syndecan interactions
Defective B4GALT7 causes EDS, progeroid type
Defective B3GAT3 causes JDSSDHD
Defective EXT2 causes exostoses 2
Defective EXT1 causes exostoses 1, TRPS2 and CHDS
Defective B3GALT6 causes EDSP2 and SEMDJL1
Other interleukin signaling
Retinoid metabolism and transport