Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6376
Gene name Gene Name - the full gene name approved by the HGNC.
C-X3-C motif chemokine ligand 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CX3CL1
Synonyms (NCBI Gene) Gene synonyms aliases
ABCD-3, C3Xkine, CXC3, CXC3C, NTN, NTT, SCYD1, fractalkine, neurotactin
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q21
Summary Summary of gene provided in NCBI Entrez Gene.
This gene belongs to the CX3C subgroup of chemokines, characterized by the number of amino acids located between the conserved cysteine residues. This is the only member of the CX3C subgroup, which contains three amino acids between cysteine residues, res
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT725028 hsa-miR-605-5p HITS-CLIP 19536157
MIRT725027 hsa-miR-2681-3p HITS-CLIP 19536157
MIRT725026 hsa-miR-3688-3p HITS-CLIP 19536157
MIRT725025 hsa-miR-490-5p HITS-CLIP 19536157
MIRT725024 hsa-miR-4308 HITS-CLIP 19536157
Transcription factors
Transcription factor Regulation Reference
WT1 Unknown 17430890
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001774 Process Microglial cell activation ISS
GO:0001954 Process Positive regulation of cell-matrix adhesion TAS 24352739
GO:0002052 Process Positive regulation of neuroblast proliferation ISS
GO:0002523 Process Leukocyte migration involved in inflammatory response IMP 23125415
GO:0002931 Process Response to ischemia ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601880 10647 ENSG00000006210
Protein
UniProt ID P78423
Protein name Fractalkine (C-X3-C motif chemokine 1) (CX3C membrane-anchored chemokine) (Neurotactin) (Small-inducible cytokine D1) [Cleaved into: Processed fractalkine]
Protein function Chemokine that acts as a ligand for both CX3CR1 and integrins ITGAV:ITGB3 and ITGA4:ITGB1 (PubMed:12055230, PubMed:21829356, PubMed:23125415, PubMed:9782118, PubMed:9931005). The CX3CR1-CX3CL1 signaling exerts distinct functions in different tis
PDB 1B2T , 1F2L , 3ONA , 4XT1 , 4XT3 , 5WB2 , 7RKF , 7RKM , 7RKN , 7XBX
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8 31 89 Small cytokines (intecrine/chemokine), interleukin-8 like Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the seminal plasma, endometrial fluid and follicular fluid (at protein level). Small intestine, colon, testis, prostate, heart, brain, lung, skeletal muscle, kidney and pancreas. Most abundant in the brain and heart. {ECO:
Sequence
MAPISLSWLLRLATFCHLTVLLAGQHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGK
RAIILETRQHRLFCADPKEQWVKDAMQHL
DRQAAALTRNGGTFEKQIGEVKPRTTPAAGG
MDESVVLEPEATGESSSLEPTPSSQEAQRALGTSPELPTGVTGSSGTRLPPTPKAQDGGP
VGTELFRVPPVSTAATWQSSAPHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENA
PSEGQRVWGQGQSPRPENSLEREEMGPVPAHTDAFQDWGPGSMAHVSVVPVSSEGTPSRE
PVASGSWTPKAEEPIHATMDPQRLGVLITPVPDAQAATRRQAVGLLAFLGLLFCLGVAMF
TYQSLQGCPRKMAGEMAEGLRYIPRSCGSNSYVLVPV
Sequence length 397
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
Efferocytosis
TNF signaling pathway
Human cytomegalovirus infection
  Chemokine receptors bind chemokines
G alpha (i) signalling events
<