Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6376
Gene name Gene Name - the full gene name approved by the HGNC.	C-X3-C motif chemokine ligand 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CX3CL1
Synonyms (NCBI Gene) Gene synonyms aliases	ABCD-3, C3Xkine, CXC3, CXC3C, NTN, NTT, SCYD1, fractalkine, neurotactin
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16q21
Summary Summary of gene provided in NCBI Entrez Gene.	This gene belongs to the CX3C subgroup of chemokines, characterized by the number of amino acids located between the conserved cysteine residues. This is the only member of the CX3C subgroup, which contains three amino acids between cysteine residues, res

Show/Hide all(180)

miRTarBase ID	miRNA	Experiments	Reference
MIRT725028	hsa-miR-605-5p	HITS-CLIP	19536157
MIRT725027	hsa-miR-2681-3p	HITS-CLIP	19536157
MIRT725026	hsa-miR-3688-3p	HITS-CLIP	19536157
MIRT725025	hsa-miR-490-5p	HITS-CLIP	19536157
MIRT725024	hsa-miR-4308	HITS-CLIP	19536157
MIRT725023	hsa-miR-4292	HITS-CLIP	19536157
MIRT725022	hsa-miR-6791-5p	HITS-CLIP	19536157
MIRT725021	hsa-miR-7152-3p	HITS-CLIP	19536157
MIRT725020	hsa-miR-5093	HITS-CLIP	19536157
MIRT725028	hsa-miR-605-5p	HITS-CLIP	19536157
MIRT725027	hsa-miR-2681-3p	HITS-CLIP	19536157
MIRT725026	hsa-miR-3688-3p	HITS-CLIP	19536157
MIRT725025	hsa-miR-490-5p	HITS-CLIP	19536157
MIRT725024	hsa-miR-4308	HITS-CLIP	19536157
MIRT725023	hsa-miR-4292	HITS-CLIP	19536157
MIRT725022	hsa-miR-6791-5p	HITS-CLIP	19536157
MIRT725021	hsa-miR-7152-3p	HITS-CLIP	19536157
MIRT725020	hsa-miR-5093	HITS-CLIP	19536157
MIRT917501	hsa-miR-1185	CLIP-seq
MIRT917502	hsa-miR-1262	CLIP-seq
MIRT917503	hsa-miR-1264	CLIP-seq
MIRT917504	hsa-miR-1293	CLIP-seq
MIRT917505	hsa-miR-1343	CLIP-seq
MIRT917506	hsa-miR-2110	CLIP-seq
MIRT917507	hsa-miR-214	CLIP-seq
MIRT917508	hsa-miR-27a	CLIP-seq
MIRT917509	hsa-miR-27b	CLIP-seq
MIRT917510	hsa-miR-3124-3p	CLIP-seq
MIRT917511	hsa-miR-3176	CLIP-seq
MIRT917512	hsa-miR-3189-3p	CLIP-seq
MIRT917513	hsa-miR-3605-5p	CLIP-seq
MIRT917514	hsa-miR-3613-3p	CLIP-seq
MIRT917515	hsa-miR-3614-3p	CLIP-seq
MIRT917516	hsa-miR-3616-3p	CLIP-seq
MIRT917517	hsa-miR-3619-5p	CLIP-seq
MIRT917518	hsa-miR-3679-5p	CLIP-seq
MIRT917519	hsa-miR-3685	CLIP-seq
MIRT917520	hsa-miR-384	CLIP-seq
MIRT917521	hsa-miR-3919	CLIP-seq
MIRT917522	hsa-miR-3922-3p	CLIP-seq
MIRT917523	hsa-miR-3925-5p	CLIP-seq
MIRT917524	hsa-miR-4271	CLIP-seq
MIRT917525	hsa-miR-4291	CLIP-seq
MIRT917526	hsa-miR-432	CLIP-seq
MIRT917527	hsa-miR-4436b-3p	CLIP-seq
MIRT917528	hsa-miR-4443	CLIP-seq
MIRT917529	hsa-miR-4447	CLIP-seq
MIRT917530	hsa-miR-4472	CLIP-seq
MIRT917531	hsa-miR-4483	CLIP-seq
MIRT917532	hsa-miR-4651	CLIP-seq
MIRT917533	hsa-miR-4667-5p	CLIP-seq
MIRT917534	hsa-miR-4700-5p	CLIP-seq
MIRT917535	hsa-miR-4701-3p	CLIP-seq
MIRT917536	hsa-miR-4725-3p	CLIP-seq
MIRT917537	hsa-miR-4757-5p	CLIP-seq
MIRT917538	hsa-miR-4773	CLIP-seq
MIRT917539	hsa-miR-483-5p	CLIP-seq
MIRT917540	hsa-miR-513a-5p	CLIP-seq
MIRT917541	hsa-miR-542-5p	CLIP-seq
MIRT917542	hsa-miR-548al	CLIP-seq
MIRT917543	hsa-miR-608	CLIP-seq
MIRT917544	hsa-miR-761	CLIP-seq
MIRT917545	hsa-miR-922	CLIP-seq
MIRT917502	hsa-miR-1262	CLIP-seq
MIRT917504	hsa-miR-1293	CLIP-seq
MIRT917512	hsa-miR-3189-3p	CLIP-seq
MIRT917529	hsa-miR-4447	CLIP-seq
MIRT917530	hsa-miR-4472	CLIP-seq
MIRT917531	hsa-miR-4483	CLIP-seq
MIRT917532	hsa-miR-4651	CLIP-seq
MIRT917535	hsa-miR-4701-3p	CLIP-seq
MIRT917543	hsa-miR-608	CLIP-seq
MIRT1972050	hsa-miR-1182	CLIP-seq
MIRT1972051	hsa-miR-1207-5p	CLIP-seq
MIRT1972052	hsa-miR-1233	CLIP-seq
MIRT1972053	hsa-miR-1972	CLIP-seq
MIRT917512	hsa-miR-3189-3p	CLIP-seq
MIRT917527	hsa-miR-4436b-3p	CLIP-seq
MIRT1972054	hsa-miR-4488	CLIP-seq
MIRT1972055	hsa-miR-4687-5p	CLIP-seq
MIRT1972056	hsa-miR-4697-5p	CLIP-seq
MIRT1972057	hsa-miR-4763-3p	CLIP-seq
MIRT1972050	hsa-miR-1182	CLIP-seq
MIRT2207770	hsa-miR-1183	CLIP-seq
MIRT917501	hsa-miR-1185	CLIP-seq
MIRT2207771	hsa-miR-1206	CLIP-seq
MIRT1972051	hsa-miR-1207-5p	CLIP-seq
MIRT2207772	hsa-miR-1224-3p	CLIP-seq
MIRT2207773	hsa-miR-1226	CLIP-seq
MIRT2207774	hsa-miR-125a-5p	CLIP-seq
MIRT2207775	hsa-miR-125b	CLIP-seq
MIRT2207776	hsa-miR-1260	CLIP-seq
MIRT2207777	hsa-miR-1260b	CLIP-seq
MIRT917502	hsa-miR-1262	CLIP-seq
MIRT2207778	hsa-miR-1273f	CLIP-seq
MIRT2207779	hsa-miR-1278	CLIP-seq
MIRT2207780	hsa-miR-1280	CLIP-seq
MIRT2207781	hsa-miR-1286	CLIP-seq
MIRT917504	hsa-miR-1293	CLIP-seq
MIRT2207782	hsa-miR-143	CLIP-seq
MIRT2207783	hsa-miR-1909	CLIP-seq
MIRT917507	hsa-miR-214	CLIP-seq
MIRT2207784	hsa-miR-2467-3p	CLIP-seq
MIRT2207785	hsa-miR-3169	CLIP-seq
MIRT917512	hsa-miR-3189-3p	CLIP-seq
MIRT2207786	hsa-miR-3194-5p	CLIP-seq
MIRT2207787	hsa-miR-342-5p	CLIP-seq
MIRT917513	hsa-miR-3605-5p	CLIP-seq
MIRT917517	hsa-miR-3619-5p	CLIP-seq
MIRT2207788	hsa-miR-3678-3p	CLIP-seq
MIRT917518	hsa-miR-3679-5p	CLIP-seq
MIRT2207789	hsa-miR-3689a-3p	CLIP-seq
MIRT2207790	hsa-miR-3689c	CLIP-seq
MIRT2207791	hsa-miR-4260	CLIP-seq
MIRT2207792	hsa-miR-4283	CLIP-seq
MIRT2207793	hsa-miR-4319	CLIP-seq
MIRT917527	hsa-miR-4436b-3p	CLIP-seq
MIRT917529	hsa-miR-4447	CLIP-seq
MIRT917530	hsa-miR-4472	CLIP-seq
MIRT917531	hsa-miR-4483	CLIP-seq
MIRT1972054	hsa-miR-4488	CLIP-seq
MIRT2207794	hsa-miR-4489	CLIP-seq
MIRT2207795	hsa-miR-4492	CLIP-seq
MIRT2207796	hsa-miR-4498	CLIP-seq
MIRT2207797	hsa-miR-4505	CLIP-seq
MIRT2207798	hsa-miR-4530	CLIP-seq
MIRT2207799	hsa-miR-4641	CLIP-seq
MIRT917532	hsa-miR-4651	CLIP-seq
MIRT2207800	hsa-miR-4661-3p	CLIP-seq
MIRT2207801	hsa-miR-4664-5p	CLIP-seq
MIRT1972056	hsa-miR-4697-5p	CLIP-seq
MIRT917535	hsa-miR-4701-3p	CLIP-seq
MIRT2207802	hsa-miR-4708-5p	CLIP-seq
MIRT2207803	hsa-miR-4728-5p	CLIP-seq
MIRT2207804	hsa-miR-4731-5p	CLIP-seq
MIRT2207805	hsa-miR-4733-3p	CLIP-seq
MIRT2207806	hsa-miR-4755-3p	CLIP-seq
MIRT1972057	hsa-miR-4763-3p	CLIP-seq
MIRT2207807	hsa-miR-4770	CLIP-seq
MIRT917539	hsa-miR-483-5p	CLIP-seq
MIRT2207808	hsa-miR-541	CLIP-seq
MIRT917541	hsa-miR-542-5p	CLIP-seq
MIRT917542	hsa-miR-548al	CLIP-seq
MIRT917543	hsa-miR-608	CLIP-seq
MIRT2207809	hsa-miR-654-5p	CLIP-seq
MIRT917544	hsa-miR-761	CLIP-seq
MIRT2207810	hsa-miR-762	CLIP-seq
MIRT917545	hsa-miR-922	CLIP-seq
MIRT917502	hsa-miR-1262	CLIP-seq
MIRT917504	hsa-miR-1293	CLIP-seq
MIRT2207784	hsa-miR-2467-3p	CLIP-seq
MIRT917512	hsa-miR-3189-3p	CLIP-seq
MIRT917527	hsa-miR-4436b-3p	CLIP-seq
MIRT917529	hsa-miR-4447	CLIP-seq
MIRT917530	hsa-miR-4472	CLIP-seq
MIRT917531	hsa-miR-4483	CLIP-seq
MIRT2207795	hsa-miR-4492	CLIP-seq
MIRT2207796	hsa-miR-4498	CLIP-seq
MIRT2207797	hsa-miR-4505	CLIP-seq
MIRT2207798	hsa-miR-4530	CLIP-seq
MIRT917532	hsa-miR-4651	CLIP-seq
MIRT917535	hsa-miR-4701-3p	CLIP-seq
MIRT917543	hsa-miR-608	CLIP-seq
MIRT2207810	hsa-miR-762	CLIP-seq
MIRT917510	hsa-miR-3124-3p	CLIP-seq
MIRT2447841	hsa-miR-4469	CLIP-seq
MIRT2447842	hsa-miR-4777-3p	CLIP-seq
MIRT2447843	hsa-miR-642a	CLIP-seq
MIRT917510	hsa-miR-3124-3p	CLIP-seq
MIRT2447841	hsa-miR-4469	CLIP-seq
MIRT2447842	hsa-miR-4777-3p	CLIP-seq
MIRT2447843	hsa-miR-642a	CLIP-seq
MIRT917510	hsa-miR-3124-3p	CLIP-seq
MIRT2447841	hsa-miR-4469	CLIP-seq
MIRT2447842	hsa-miR-4777-3p	CLIP-seq
MIRT2447843	hsa-miR-642a	CLIP-seq
MIRT917510	hsa-miR-3124-3p	CLIP-seq
MIRT2447841	hsa-miR-4469	CLIP-seq
MIRT2447842	hsa-miR-4777-3p	CLIP-seq
MIRT2447843	hsa-miR-642a	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
WT1	Unknown	17430890

Show/Hide all(98)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001774	Process	Microglial cell activation	ISS
GO:0001954	Process	Positive regulation of cell-matrix adhesion	TAS	24352739
GO:0002052	Process	Positive regulation of neuroblast proliferation	ISS
GO:0002523	Process	Leukocyte migration involved in inflammatory response	IMP	23125415
GO:0002548	Process	Monocyte chemotaxis	IBA	21873635
GO:0002931	Process	Response to ischemia	ISS
GO:0005102	Function	Signaling receptor binding	TAS	12714508
GO:0005178	Function	Integrin binding	IDA	23125415
GO:0005515	Function	Protein binding	IPI	9931005, 23125415, 24789099, 25745166
GO:0005576	Component	Extracellular region	IDA	10415068, 12714508
GO:0005576	Component	Extracellular region	IMP	10899174
GO:0005576	Component	Extracellular region	ISS
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS	24352739
GO:0006935	Process	Chemotaxis	IDA	21829356
GO:0006935	Process	Chemotaxis	IMP	23125415
GO:0006952	Process	Defense response	TAS	12714508
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0006955	Process	Immune response	TAS	12714508
GO:0007155	Process	Cell adhesion	IPI	10187784
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	ISS
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007267	Process	Cell-cell signaling	TAS	24352739
GO:0007568	Process	Aging	ISS
GO:0008009	Function	Chemokine activity	IBA	21873635
GO:0008009	Function	Chemokine activity	IDA	21829356
GO:0008009	Function	Chemokine activity	IGI	10415068
GO:0008009	Function	Chemokine activity	TAS	12714508, 24352739
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	24294368
GO:0009986	Component	Cell surface	IDA	12714508
GO:0010812	Process	Negative regulation of cell-substrate adhesion	NAS	24352739
GO:0010976	Process	Positive regulation of neuron projection development	ISS
GO:0016020	Component	Membrane	IDA	10899174
GO:0016020	Component	Membrane	ISS
GO:0016021	Component	Integral component of membrane	IDA	12714508
GO:0016322	Process	Neuron remodeling	TAS	20920788
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS	11777952
GO:0030336	Process	Negative regulation of cell migration	IDA	25435433
GO:0030593	Process	Neutrophil chemotaxis	IBA	21873635
GO:0030595	Process	Leukocyte chemotaxis	TAS	11777952
GO:0031664	Process	Regulation of lipopolysaccharide-mediated signaling pathway	IDA	10652441
GO:0031737	Function	CX3C chemokine receptor binding	IDA	10415068, 23125415
GO:0031737	Function	CX3C chemokine receptor binding	NAS	20018408
GO:0031737	Function	CX3C chemokine receptor binding	TAS	24352739
GO:0032233	Process	Positive regulation of actin filament bundle assembly	IGI	10415068
GO:0032690	Process	Negative regulation of interleukin-1 alpha production	ISS
GO:0032691	Process	Negative regulation of interleukin-1 beta production	TAS	20018408
GO:0032715	Process	Negative regulation of interleukin-6 production	TAS	20018408
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IDA	10652441
GO:0032720	Process	Negative regulation of tumor necrosis factor production	TAS	20018408
GO:0033622	Process	Integrin activation	IMP	23125415
GO:0035425	Process	Autocrine signaling	ISS
GO:0042056	Function	Chemoattractant activity	IMP	10899174
GO:0042995	Component	Cell projection	ISS
GO:0043025	Component	Neuronal cell body	ISS
GO:0043066	Process	Negative regulation of apoptotic process	IMP	24294368
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	ISS
GO:0043410	Process	Positive regulation of MAPK cascade	IGI	10415068
GO:0043547	Process	Positive regulation of GTPase activity	IBA	21873635
GO:0045237	Function	CXCR1 chemokine receptor binding	IPI	10187784
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0048020	Function	CCR chemokine receptor binding	IBA	21873635
GO:0048167	Process	Regulation of synaptic plasticity	TAS	24352739
GO:0048245	Process	Eosinophil chemotaxis	IBA	21873635
GO:0048247	Process	Lymphocyte chemotaxis	IBA	21873635
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	ISS
GO:0050729	Process	Positive regulation of inflammatory response	IEP	11777952
GO:0050767	Process	Regulation of neurogenesis	TAS	24352739
GO:0050902	Process	Leukocyte adhesive activation	TAS	12714508
GO:0050918	Process	Positive chemotaxis	IMP	10899174
GO:0051041	Process	Positive regulation of calcium-independent cell-cell adhesion	IDA	12714508
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IGI	10869418
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IGI	10415068, 10869418
GO:0051897	Process	Positive regulation of protein kinase B signaling	IGI	10415068, 10869418
GO:0051897	Process	Positive regulation of protein kinase B signaling	ISS
GO:0060326	Process	Cell chemotaxis	IDA	10415068
GO:0061518	Process	Microglial cell proliferation	IMP	12125082
GO:0070050	Process	Neuron cellular homeostasis	ISS
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA	21873635
GO:0070098	Process	Chemokine-mediated signaling pathway	IDA	10415068
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA	21873635
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	TAS	24352739
GO:0071346	Process	Cellular response to interferon-gamma	IBA	21873635
GO:0071347	Process	Cellular response to interleukin-1	IBA	21873635
GO:0071356	Process	Cellular response to tumor necrosis factor	IBA	21873635
GO:0098609	Process	Cell-cell adhesion	ISS
GO:0098609	Process	Cell-cell adhesion	TAS	24352739
GO:0098883	Process	Synapse pruning	TAS	20920788
GO:0110091	Process	Negative regulation of hippocampal neuron apoptotic process	IGI	10869418
GO:1900450	Process	Negative regulation of glutamate receptor signaling pathway	ISS
GO:1903721	Process	Positive regulation of I-kappaB phosphorylation	IGI	10869418
GO:1903979	Process	Negative regulation of microglial cell activation	ISS
GO:1904141	Process	Positive regulation of microglial cell migration	IDA	10415068
GO:2001223	Process	Negative regulation of neuron migration	TAS	24352739
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	IGI	10869418

MIM	HGNC	e!Ensembl
601880	10647	ENSG00000006210

Protein

UniProt ID

P78423

Protein name

Fractalkine (C-X3-C motif chemokine 1) (CX3C membrane-anchored chemokine) (Neurotactin) (Small-inducible cytokine D1) [Cleaved into: Processed fractalkine]

Protein function

Chemokine that acts as a ligand for both CX3CR1 and integrins ITGAV:ITGB3 and ITGA4:ITGB1 (PubMed:12055230, PubMed:21829356, PubMed:23125415, PubMed:9782118, PubMed:9931005). The CX3CR1-CX3CL1 signaling exerts distinct functions in different tis

PDB

1B2T , 1F2L , 3ONA , 4XT1 , 4XT3 , 5WB2 , 7RKF , 7RKM , 7RKN , 7XBX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00048	IL8	31 → 89	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the seminal plasma, endometrial fluid and follicular fluid (at protein level). Small intestine, colon, testis, prostate, heart, brain, lung, skeletal muscle, kidney and pancreas. Most abundant in the brain and heart. {ECO:

Sequence

MAPISLSWLLRLATFCHLTVLLAGQHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGK
RAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGG
MDESVVLEPEATGESSSLEPTPSSQEAQRALGTSPELPTGVTGSSGTRLPPTPKAQDGGP
VGTELFRVPPVSTAATWQSSAPHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENA
PSEGQRVWGQGQSPRPENSLEREEMGPVPAHTDAFQDWGPGSMAHVSVVPVSSEGTPSRE
PVASGSWTPKAEEPIHATMDPQRLGVLITPVPDAQAATRRQAVGLLAFLGLLFCLGVAMF
TYQSLQGCPRKMAGEMAEGLRYIPRSCGSNSYVLVPV

Sequence length

397

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor Chemokine signaling pathway Efferocytosis TNF signaling pathway Human cytomegalovirus infection		Chemokine receptors bind chemokines G alpha (i) signalling events

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17199135

Show/Hide Text Mining Associations (178)

Disease Name	Relationship Type	References
Associations from Text Mining
Abortion Spontaneous	Associate	36096448
Adenocarcinoma	Associate	26633537, 30150990
Adenocarcinoma of Lung	Associate	35494513
Alopecia Areata	Associate	20546884
Alzheimer Disease	Stimulate	30092003, 32592865
Anemia Aplastic	Stimulate	24528288
Angina Unstable	Associate	20019415, 22664781
Angina Unstable	Stimulate	25424368
Anophthalmia with pulmonary hypoplasia	Associate	29274778
Anorexia Nervosa	Associate	33498837
Aortic Aneurysm Abdominal	Associate	18296082, 31539405
Aortic Aneurysm Familial Abdominal 1	Associate	18296082
Arthritis	Associate	32884948
Arthritis Rheumatoid	Associate	11583978, 12428227, 15880821, 17471309, 17665439
Arthritis Rheumatoid	Stimulate	20185962
Asthma	Associate	16424217, 20523302, 28859129
Atherosclerosis	Associate	17456471, 17591977, 19840952, 20019415, 21525510, 21873805, 24307998, 25040843, 29406386, 38256102
Breast Neoplasms	Associate	29274778, 35045088, 35294039, 37040163
Breast Neoplasms	Stimulate	32321535
Bronchiolitis Obliterans Syndrome	Associate	17264819
Cap Myopathy	Associate	27509989
Carcinogenesis	Associate	19457610
Carcinoma Hepatocellular	Associate	20922190, 25926643, 36938723, 39273406, 40051011
Carcinoma Non Small Cell Lung	Associate	33754027
Carcinoma Ovarian Epithelial	Associate	22064656
Carcinoma Pancreatic Ductal	Associate	29867042
Carcinoma Renal Cell	Inhibit	22699780
Carcinoma Renal Cell	Associate	35734169, 36397015
Cardiomyopathies	Associate	36936778
Carotid Stenosis	Associate	28677375, 33319833
Celiac Disease	Stimulate	28934294
Cerebral Palsy	Associate	40594558
Cerebrovascular Disorders	Stimulate	37679252
Cheilitis glandularis	Stimulate	28285559
Chemical and Drug Induced Liver Injury	Stimulate	23765258
Cholangitis	Associate	23765258
Choreoathetosis Hypothyroidism And Neonatal Respiratory Distress	Associate	35045088
Chronic Kidney Disease Mineral and Bone Disorder	Associate	36799882
Colitis Collagenous	Stimulate	25948880
Colitis Lymphocytic	Stimulate	25948880
Colonic Neoplasms	Associate	35572821
Communicable Diseases	Associate	32592865
Coronary Artery Disease	Associate	17456471, 20523302, 22664781, 25424368, 26191329
COVID 19	Associate	33836338, 34450402
Cystic Fibrosis	Associate	19000946
Cytokine Release Syndrome	Associate	15880821, 20922190
Cytokine Release Syndrome	Stimulate	33190387
Delirium	Stimulate	32592865
Demyelinating Diseases	Associate	37924373
Depressive Disorder Major	Associate	30870525
Dermatitis Atopic	Associate	15131578
Dermatitis Atopic	Stimulate	28821884
Diabetes Mellitus	Associate	23956503
Diabetes Mellitus Type 2	Associate	21525510
digital ulcers	Stimulate	15608300
Disease	Associate	31652730
Dowling Degos Disease	Stimulate	21356322
Drug Hypersensitivity	Associate	37876509
Dry Eye Syndromes	Associate	37876509, 39884388
Endometriosis	Associate	23517860, 24294368, 24427339
Endotoxemia	Associate	21525510
Esophageal Neoplasms	Associate	31385574
Exfoliation Syndrome	Associate	33914756
Fibrosis	Associate	19153557, 23324439, 25587706
Fibrosis	Stimulate	23765258
Glioblastoma	Associate	32346064, 38287522
Glioma	Inhibit	20511186
Glomerulonephritis	Associate	24284376
Glomerulonephritis IGA	Associate	22572859, 22892858
Glomerulosclerosis Focal Segmental	Associate	35693262
Glycosuria Renal	Associate	25587706
Hematuria	Associate	22572859, 22892858
Hepatic Encephalopathy	Associate	28751644
Hepatitis Autoimmune	Associate	37108648
Hepatitis B	Associate	25926643
Hereditary leiomyomatosis and renal cell cancer	Associate	18070985
HIV Infections	Associate	11535497
Hodgkin Disease	Associate	18070985, 21385932
Hyperglycemia	Stimulate	28655972
Hypertensive Retinopathy	Associate	26710229
Hypoxia	Stimulate	23956503, 24270813
Hypoxia	Associate	26496926, 31077234, 35186183
Idiopathic Pulmonary Fibrosis	Associate	32922201
IgA Vasculitis	Associate	15880821
Infections	Associate	28944873
Inflammation	Associate	15131578, 15608300, 17456471, 18296082, 19432809, 19723636, 22313962, 23324439, 23765258, 23956503, 24270813, 24427339, 28522896, 28655972, 29406386 View all (7 more)
Inflammation	Stimulate	20922190, 21525510, 24600034, 29867042, 37679252
Inflammatory Bowel Diseases	Associate	17241867
Insulin Resistance	Associate	22709547
Intervertebral Disc Degeneration	Stimulate	21356322
Iron Deficiencies	Associate	37175630, 37373063
Joint Diseases	Associate	21356322, 32884948
Kidney Diseases	Associate	34689723
Kidney Failure Chronic	Associate	33672355
Lewy Body Disease	Associate	40613333
Liver Cirrhosis Biliary	Stimulate	23765258
Liver Cirrhosis Biliary	Associate	33710617
Liver Diseases	Associate	19432809
Liver Failure	Associate	19432809
Lung Diseases	Associate	35186183
Lung Injury	Associate	34685562
Lung Neoplasms	Associate	27156946, 37770496
Lupus Erythematosus Systemic	Associate	15934075, 33665864
Lupus Erythematosus Systemic	Stimulate	33708222
Macular Degeneration	Associate	25503251
Mastitis	Associate	39399489
Microvascular Angina	Associate	26168217
Multiple Myeloma	Associate	34761615
Multiple Sclerosis	Associate	31191554
Multiple System Atrophy	Associate	29850876
Myocardial Infarction	Stimulate	22664781
Myocardial Infarction	Associate	37679252
Nasal Polyps	Associate	22344830
Neoplasm Metastasis	Associate	22064656, 26496926, 27509989, 28122354, 31077234, 31385574, 33754027, 35494513, 36397015, 37040163
Neoplasm Metastasis	Stimulate	32321535
Neoplasms	Associate	20511186, 21059815, 22064656, 26796342, 27156946, 31442303, 32321535, 33754027, 36397015, 37040163, 37082943
Neoplasms	Inhibit	22699780
Neoplasms Adipose Tissue	Associate	22709547
Nerve Degeneration	Associate	21356322
Neuralgia	Stimulate	19153557
Neuroblastoma	Inhibit	22253825
Neurodegenerative Diseases	Associate	32941527
Neuroinflammatory Diseases	Associate	40594558
Neurologic Manifestations	Stimulate	34450402
Neuromyelitis Optica	Associate	32753407
Obesity	Stimulate	21525510
Obesity	Associate	30150990
Osteoarthritis	Associate	19302240, 32884948
Osteoarthritis	Stimulate	21356322
Osteosarcoma	Associate	30468463
Ovarian Neoplasms	Associate	22064656, 26633537, 31077234
Pain	Associate	19153557, 23324439
Pain	Inhibit	34602367
Pancreatic Neoplasms	Associate	29274778, 29867042
Pancreatitis	Associate	19153557, 29274778
Pancreatitis Chronic	Stimulate	19030200
Pancreatitis Chronic	Associate	19153557, 23324439
Parasitic Diseases	Associate	36936778
Parkinson Disease	Associate	26497684
Periodontal Diseases	Associate	15730397
Peripheral Arterial Disease	Associate	39221259
Plaque Atherosclerotic	Associate	25383745, 26710229, 28677375, 32229536
Pleural Effusion	Stimulate	35819097
Polycystic Ovary Syndrome	Inhibit	27386819
Pre Eclampsia	Stimulate	25769431
Pre Eclampsia	Associate	30606080
Prostatic Neoplasms	Associate	19047106, 26496926, 27509989
Pulmonary Arterial Hypertension	Associate	16584113, 35186183
Pulmonary Disease Chronic Obstructive	Associate	34335580
Pulmonary Fibrosis	Stimulate	15608300
Pulmonary Fibrosis	Associate	33665864
Renal Insufficiency Chronic	Stimulate	21873805, 36591354
Renal Insufficiency Chronic	Associate	24111715, 25587706, 30249039
Reperfusion Injury	Associate	26168217
Respiratory Distress Syndrome	Associate	32321279
Retinal Vein Occlusion	Associate	31814701
Retinoblastoma	Associate	37603355
Rheumatoid Vasculitis	Associate	17075825
Rhinitis Allergic	Associate	17982926
Roberts Syndrome	Stimulate	33319833
Rupture	Associate	20019415, 22664781
Scleroderma Diffuse	Stimulate	31667578
Scleroderma Systemic	Associate	15608300, 16584113
Scleroderma Systemic	Stimulate	31667578
Sickle Cell Trait	Associate	37533140
Skin Manifestations	Associate	15934075
Soft Tissue Injuries	Stimulate	19153557
Spinal Dysraphism	Associate	35294039
Squamous Cell Carcinoma of Head and Neck	Associate	37082943
Status Asthmaticus	Stimulate	16424217
Status Asthmaticus	Associate	28859129
Stomach Neoplasms	Associate	24764683
Tarlov Cysts	Associate	24764683
Thrombosis	Associate	33836338
Tourette Syndrome	Associate	36674940
Urinary Bladder Neoplasms	Stimulate	28285559
Vascular Diseases	Associate	40508061
Vascular System Injuries	Associate	15608300

CX3CL1 (C-X3-C motif chemokine ligand 1)