Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6374
Gene name	C-X-C motif chemokine ligand 5
Gene symbol	CXCL5
Synonyms (NCBI Gene)	ENA-78SCYB5
Chromosome	4
Chromosome location	4q13.3
Summary	This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This protein is proposed to bind the G-protein co

228

Show/Hide all (228)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019453	hsa-miR-148b-3p	Microarray	17612493
MIRT025829	hsa-miR-7-5p	Microarray	19073608
MIRT707535	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT707534	hsa-miR-369-3p	HITS-CLIP	21572407
MIRT707532	hsa-miR-5692b	HITS-CLIP	21572407
MIRT707533	hsa-miR-5692c	HITS-CLIP	21572407
MIRT707531	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT707530	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT707529	hsa-miR-656-3p	HITS-CLIP	21572407
MIRT707528	hsa-miR-374a-5p	HITS-CLIP	21572407
MIRT707527	hsa-miR-374b-5p	HITS-CLIP	21572407
MIRT707526	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT659245	hsa-miR-495-3p	HITS-CLIP	23824327
MIRT659244	hsa-miR-5688	HITS-CLIP	23824327
MIRT620652	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT620651	hsa-miR-8063	HITS-CLIP	23824327
MIRT620650	hsa-miR-3065-5p	HITS-CLIP	23824327
MIRT620649	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT620648	hsa-miR-1248	HITS-CLIP	23824327
MIRT620647	hsa-miR-3655	HITS-CLIP	23824327
MIRT620646	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT620645	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT620644	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT620643	hsa-miR-511-5p	HITS-CLIP	23824327
MIRT659243	hsa-miR-578	HITS-CLIP	23824327
MIRT620652	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT620651	hsa-miR-8063	HITS-CLIP	23824327
MIRT620650	hsa-miR-3065-5p	HITS-CLIP	23824327
MIRT620649	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT620648	hsa-miR-1248	HITS-CLIP	23824327
MIRT620647	hsa-miR-3655	HITS-CLIP	23824327
MIRT620646	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT620645	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT620644	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT620643	hsa-miR-511-5p	HITS-CLIP	23824327
MIRT620646	hsa-miR-3124-3p	PAR-CLIP	27292025
MIRT736788	hsa-miR-588	Western blottingImmunohistochemistry (IHC)qRT-PCR	33323542
MIRT707535	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT707534	hsa-miR-369-3p	HITS-CLIP	21572407
MIRT707532	hsa-miR-5692b	HITS-CLIP	21572407
MIRT707533	hsa-miR-5692c	HITS-CLIP	21572407
MIRT707531	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT707530	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT707529	hsa-miR-656-3p	HITS-CLIP	21572407
MIRT707528	hsa-miR-374a-5p	HITS-CLIP	21572407
MIRT707527	hsa-miR-374b-5p	HITS-CLIP	21572407
MIRT707526	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT659245	hsa-miR-495-3p	HITS-CLIP	23824327
MIRT659244	hsa-miR-5688	HITS-CLIP	23824327
MIRT620652	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT620651	hsa-miR-8063	HITS-CLIP	23824327
MIRT620650	hsa-miR-3065-5p	HITS-CLIP	23824327
MIRT620649	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT620648	hsa-miR-1248	HITS-CLIP	23824327
MIRT620647	hsa-miR-3655	HITS-CLIP	23824327
MIRT620646	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT620645	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT620644	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT620643	hsa-miR-511-5p	HITS-CLIP	23824327
MIRT659243	hsa-miR-578	HITS-CLIP	23824327
MIRT620652	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT620651	hsa-miR-8063	HITS-CLIP	23824327
MIRT620650	hsa-miR-3065-5p	HITS-CLIP	23824327
MIRT620649	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT620648	hsa-miR-1248	HITS-CLIP	23824327
MIRT620647	hsa-miR-3655	HITS-CLIP	23824327
MIRT620646	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT620645	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT620644	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT620643	hsa-miR-511-5p	HITS-CLIP	23824327
MIRT755568	miR-145-3p	Luciferase reporter assayWestern blottingqRT-PCR	35936390
MIRT755568	miR-145-3p	Luciferase reporter assayWestern blottingqRT-PCR	35936390
MIRT918049	hsa-miR-1206	CLIP-seq
MIRT918050	hsa-miR-2053	CLIP-seq
MIRT918051	hsa-miR-21	CLIP-seq
MIRT918052	hsa-miR-23a	CLIP-seq
MIRT918053	hsa-miR-23b	CLIP-seq
MIRT918054	hsa-miR-23c	CLIP-seq
MIRT918055	hsa-miR-25	CLIP-seq
MIRT918056	hsa-miR-302f	CLIP-seq
MIRT918057	hsa-miR-32	CLIP-seq
MIRT918058	hsa-miR-330-3p	CLIP-seq
MIRT918059	hsa-miR-34a	CLIP-seq
MIRT918060	hsa-miR-34c-5p	CLIP-seq
MIRT918061	hsa-miR-361-3p	CLIP-seq
MIRT918062	hsa-miR-363	CLIP-seq
MIRT918063	hsa-miR-3646	CLIP-seq
MIRT918064	hsa-miR-367	CLIP-seq
MIRT918065	hsa-miR-3679-3p	CLIP-seq
MIRT918066	hsa-miR-4290	CLIP-seq
MIRT918067	hsa-miR-4457	CLIP-seq
MIRT918068	hsa-miR-449a	CLIP-seq
MIRT918069	hsa-miR-449b	CLIP-seq
MIRT918070	hsa-miR-4533	CLIP-seq
MIRT918071	hsa-miR-4659a-5p	CLIP-seq
MIRT918072	hsa-miR-4659b-5p	CLIP-seq
MIRT918073	hsa-miR-4747-5p	CLIP-seq
MIRT918074	hsa-miR-4753-3p	CLIP-seq
MIRT918075	hsa-miR-4766-5p	CLIP-seq
MIRT918076	hsa-miR-4768-5p	CLIP-seq
MIRT918077	hsa-miR-4776-3p	CLIP-seq
MIRT918078	hsa-miR-4778-5p	CLIP-seq
MIRT918079	hsa-miR-5096	CLIP-seq
MIRT918080	hsa-miR-513b	CLIP-seq
MIRT918081	hsa-miR-548a-5p	CLIP-seq
MIRT918082	hsa-miR-548ab	CLIP-seq
MIRT918083	hsa-miR-548ac	CLIP-seq
MIRT918084	hsa-miR-548ae	CLIP-seq
MIRT918085	hsa-miR-548aj	CLIP-seq
MIRT918086	hsa-miR-548ak	CLIP-seq
MIRT918087	hsa-miR-548am	CLIP-seq
MIRT918088	hsa-miR-548b-5p	CLIP-seq
MIRT918089	hsa-miR-548c-5p	CLIP-seq
MIRT918090	hsa-miR-548d-3p	CLIP-seq
MIRT918091	hsa-miR-548d-5p	CLIP-seq
MIRT918092	hsa-miR-548h	CLIP-seq
MIRT918093	hsa-miR-548i	CLIP-seq
MIRT918094	hsa-miR-548j	CLIP-seq
MIRT918095	hsa-miR-548n	CLIP-seq
MIRT918096	hsa-miR-548t	CLIP-seq
MIRT918097	hsa-miR-548w	CLIP-seq
MIRT918098	hsa-miR-548x	CLIP-seq
MIRT918099	hsa-miR-548y	CLIP-seq
MIRT918100	hsa-miR-548z	CLIP-seq
MIRT918101	hsa-miR-559	CLIP-seq
MIRT918102	hsa-miR-569	CLIP-seq
MIRT918103	hsa-miR-590-5p	CLIP-seq
MIRT918104	hsa-miR-597	CLIP-seq
MIRT918105	hsa-miR-656	CLIP-seq
MIRT918106	hsa-miR-670	CLIP-seq
MIRT918107	hsa-miR-92a	CLIP-seq
MIRT918108	hsa-miR-92b	CLIP-seq
MIRT1972125	hsa-miR-1224-3p	CLIP-seq
MIRT1972126	hsa-miR-1260	CLIP-seq
MIRT1972127	hsa-miR-1260b	CLIP-seq
MIRT1972128	hsa-miR-1280	CLIP-seq
MIRT1972129	hsa-miR-129-5p	CLIP-seq
MIRT1972130	hsa-miR-2052	CLIP-seq
MIRT918050	hsa-miR-2053	CLIP-seq
MIRT918055	hsa-miR-25	CLIP-seq
MIRT918056	hsa-miR-302f	CLIP-seq
MIRT918057	hsa-miR-32	CLIP-seq
MIRT918062	hsa-miR-363	CLIP-seq
MIRT918064	hsa-miR-367	CLIP-seq
MIRT1972131	hsa-miR-4307	CLIP-seq
MIRT1972132	hsa-miR-4733-3p	CLIP-seq
MIRT1972133	hsa-miR-4759	CLIP-seq
MIRT918102	hsa-miR-569	CLIP-seq
MIRT918107	hsa-miR-92a	CLIP-seq
MIRT918108	hsa-miR-92b	CLIP-seq
MIRT1972129	hsa-miR-129-5p	CLIP-seq
MIRT1972130	hsa-miR-2052	CLIP-seq
MIRT918050	hsa-miR-2053	CLIP-seq
MIRT918055	hsa-miR-25	CLIP-seq
MIRT918056	hsa-miR-302f	CLIP-seq
MIRT918057	hsa-miR-32	CLIP-seq
MIRT2207931	hsa-miR-3614-3p	CLIP-seq
MIRT918062	hsa-miR-363	CLIP-seq
MIRT918063	hsa-miR-3646	CLIP-seq
MIRT918064	hsa-miR-367	CLIP-seq
MIRT2207932	hsa-miR-4264	CLIP-seq
MIRT1972131	hsa-miR-4307	CLIP-seq
MIRT918071	hsa-miR-4659a-5p	CLIP-seq
MIRT918072	hsa-miR-4659b-5p	CLIP-seq
MIRT918075	hsa-miR-4766-5p	CLIP-seq
MIRT918077	hsa-miR-4776-3p	CLIP-seq
MIRT918078	hsa-miR-4778-5p	CLIP-seq
MIRT2207933	hsa-miR-4797-3p	CLIP-seq
MIRT918102	hsa-miR-569	CLIP-seq
MIRT918105	hsa-miR-656	CLIP-seq
MIRT918107	hsa-miR-92a	CLIP-seq
MIRT918108	hsa-miR-92b	CLIP-seq
MIRT2207934	hsa-miR-935	CLIP-seq
MIRT2511381	hsa-miR-1243	CLIP-seq
MIRT2511382	hsa-miR-1323	CLIP-seq
MIRT2511383	hsa-miR-2467-3p	CLIP-seq
MIRT2511384	hsa-miR-3120-3p	CLIP-seq
MIRT2511385	hsa-miR-3146	CLIP-seq
MIRT2511386	hsa-miR-3148	CLIP-seq
MIRT2511387	hsa-miR-3163	CLIP-seq
MIRT2511388	hsa-miR-3609	CLIP-seq
MIRT2511389	hsa-miR-3654	CLIP-seq
MIRT2511390	hsa-miR-3915	CLIP-seq
MIRT2511391	hsa-miR-3928	CLIP-seq
MIRT2511392	hsa-miR-3973	CLIP-seq
MIRT2511393	hsa-miR-4257	CLIP-seq
MIRT2511394	hsa-miR-495	CLIP-seq
MIRT2511395	hsa-miR-520g	CLIP-seq
MIRT2511396	hsa-miR-520h	CLIP-seq
MIRT2511397	hsa-miR-545	CLIP-seq
MIRT2511398	hsa-miR-548ah	CLIP-seq
MIRT2511399	hsa-miR-548o	CLIP-seq
MIRT2511400	hsa-miR-577	CLIP-seq
MIRT2511401	hsa-miR-606	CLIP-seq
MIRT2511402	hsa-miR-665	CLIP-seq
MIRT2511403	hsa-miR-875-3p	CLIP-seq
MIRT2678865	hsa-miR-1237	CLIP-seq
MIRT2511381	hsa-miR-1243	CLIP-seq
MIRT2511382	hsa-miR-1323	CLIP-seq
MIRT2511383	hsa-miR-2467-3p	CLIP-seq
MIRT2511384	hsa-miR-3120-3p	CLIP-seq
MIRT2511385	hsa-miR-3146	CLIP-seq
MIRT2511386	hsa-miR-3148	CLIP-seq
MIRT2678866	hsa-miR-3160-3p	CLIP-seq
MIRT2511387	hsa-miR-3163	CLIP-seq
MIRT2511388	hsa-miR-3609	CLIP-seq
MIRT2511389	hsa-miR-3654	CLIP-seq
MIRT2511390	hsa-miR-3915	CLIP-seq
MIRT2511391	hsa-miR-3928	CLIP-seq
MIRT2511392	hsa-miR-3973	CLIP-seq
MIRT2511393	hsa-miR-4257	CLIP-seq
MIRT2678867	hsa-miR-4470	CLIP-seq
MIRT2678868	hsa-miR-4487	CLIP-seq
MIRT2678869	hsa-miR-4663	CLIP-seq
MIRT2678870	hsa-miR-4720-3p	CLIP-seq
MIRT918075	hsa-miR-4766-5p	CLIP-seq
MIRT2511394	hsa-miR-495	CLIP-seq
MIRT2678871	hsa-miR-511	CLIP-seq
MIRT2511395	hsa-miR-520g	CLIP-seq
MIRT2511396	hsa-miR-520h	CLIP-seq
MIRT2511397	hsa-miR-545	CLIP-seq
MIRT2511398	hsa-miR-548ah	CLIP-seq
MIRT2511399	hsa-miR-548o	CLIP-seq
MIRT2678872	hsa-miR-558	CLIP-seq
MIRT2511400	hsa-miR-577	CLIP-seq
MIRT2511401	hsa-miR-606	CLIP-seq
MIRT2511402	hsa-miR-665	CLIP-seq
MIRT2511403	hsa-miR-875-3p	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
NFKB1	Unknown	11559712
RELA	Unknown	11559712
SP1	Activation	11559712
ZNF148	Unknown	11559712

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	10820279
GO:0006952	Process	Defense response	IEA
GO:0006954	Process	Inflammatory response	IBA
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	TAS	10820279
GO:0007267	Process	Cell-cell signaling	TAS	7929219
GO:0008009	Function	Chemokine activity	IBA
GO:0008009	Function	Chemokine activity	IEA
GO:0008009	Function	Chemokine activity	TAS	10820279
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	10463948
GO:0030593	Process	Neutrophil chemotaxis	IBA
GO:0042802	Function	Identical protein binding	IDA	24695525
GO:0045236	Function	CXCR chemokine receptor binding	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA

MIM	HGNC	e!Ensembl
600324	10642	ENSG00000163735

P42830

Protein name

C-X-C motif chemokine 5 (ENA-78(1-78)) (Epithelial-derived neutrophil-activating protein 78) (Neutrophil-activating peptide ENA-78) (Small-inducible cytokine B5) [Cleaved into: ENA-78(8-78); ENA-78(9-78)]

Protein function

Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes.

PDB

2MGS , 8XWS , 8XX7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00048	IL8	47 → 106	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

Sequence

MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHP
KMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

Sequence length

114

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor Chemokine signaling pathway IL-17 signaling pathway TNF signaling pathway Pertussis Rheumatoid arthritis		Chemokine receptors bind chemokines G alpha (i) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PULMONARY FIBROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (119)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Acute Coronary Syndrome	Associate	18769620	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Associate	34133324	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Inhibit	20562917	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Stimulate	35537038	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Associate	34220331	★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic Fungal Sinusitis	Stimulate	19153309, 22508623	★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic Fungal Sinusitis	Associate	26047816	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolitis Extrinsic Allergic	Associate	19535235	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Stimulate	34440700	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anastomotic Leak	Associate	32307587	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Associate	17321344	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Associate	8083342	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Associate	34963488	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Associate	18576313	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Stimulate	8083342	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Associate	17234659	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Stimulate	25871636	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Stimulate	25871636	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bacterial Infections	Stimulate	21911461	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Associate	23439434	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Resorption	Associate	25278075	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Associate	33026667	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	18045955, 19451693, 23543442, 23991131, 30867824	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Inhibit	23991131	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	30696738	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	24268047, 25011526, 28993096, 33955820, 35038357, 36938723	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	24500664, 35150082, 38642131	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Associate	28360038, 35468838	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	30867824, 32788609, 36889175	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	24500664	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Associate	23245743	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Associate	33026667	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Stimulate	35686557	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chemical and Drug Induced Liver Injury	Associate	28993096	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Associate	39670859	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Associate	33627146	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cicatrix	Associate	25970613	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Associate	25526479	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Stimulate	36857861, 37563310	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Associate	36246978	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	16101183, 30255816, 32390708, 34419055, 35283273	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Stimulate	18578857	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complex Regional Pain Syndromes	Associate	34062414	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Associate	12871498	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Inhibit	29153655	★★★★★ ★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	32920092	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Stimulate	36045687	★★★★★ ★☆☆☆☆ Found in Text Mining only
Death	Associate	34220331	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dissection Thoracic Aorta	Associate	38269483	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Associate	37717172	★★★★★ ★☆☆☆☆ Found in Text Mining only
Embolic Stroke	Associate	35686557	★★★★★ ★☆☆☆☆ Found in Text Mining only
Empyema	Stimulate	33469074	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Stimulate	37657716	★★★★★ ★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Associate	33663574, 34269788	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Associate	35936390	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Associate	11119492	★★★★★ ★☆☆☆☆ Found in Text Mining only
HAIR AN syndrome	Associate	38269483	★★★★★ ★☆☆☆☆ Found in Text Mining only
HIV Infections	Stimulate	25536401	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Associate	23245743	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia Brain	Associate	33026667	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Associate	19535235	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammation	Associate	18320069, 18578857, 18769620, 21084274, 22508623, 23285311, 23721325, 24778119, 25536401, 25871636, 27163710, 30565271, 30704100, 30867824, 32307587 View all (5 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Stimulate	25970613	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Associate	32020185	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Associate	35042389	★★★★★ ★☆☆☆☆ Found in Text Mining only
Joint Diseases	Associate	18576313	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Stimulate	37540227	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Stimulate	33469074	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	34407043	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Stimulate	19155472	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Stimulate	26503215	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Associate	33458757	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Associate	24453419	★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Associate	35197088	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	25268740	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Associate	30704100	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Inhibit	35967338	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Associate	29381915, 31772617	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Associate	23469080	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	18045955, 18578857, 22753015, 34407043, 35283273, 39670859	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Stimulate	28277189	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	18045955, 18578857, 20562917, 23469080, 23991131, 24074379, 24500664, 26503215, 28277189, 31999765, 32390708, 33458757, 34827689, 35038357, 35283273 View all (7 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	34517533	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Associate	19535235	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutrophil Immunodeficiency Syndrome	Associate	35197088	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutrophilia Hereditary	Associate	26047816	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non alcoholic Fatty Liver Disease	Associate	28993096	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non Muscle Invasive Bladder Neoplasms	Associate	26503215	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Stimulate	23439434	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta	Associate	30804325	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Stimulate	28277189	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	31999765, 35468838	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Stimulate	34764955	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Associate	34536521	★★★★★ ★☆☆☆☆ Found in Text Mining only
Penile Neoplasms	Associate	33458757	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Associate	35154475	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural Effusion	Associate	33469074	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyps	Stimulate	34060497	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	19388934	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prodromal Symptoms	Associate	24500664	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Associate	18320069	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Stimulate	18320069, 37698493	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	31636124, 36524848, 37922327	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatitis	Associate	18320069, 37698493	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Associate	33416099	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Stimulate	30154415	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyruvate Carboxylase Deficiency Disease	Associate	33458757	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seizures	Associate	23639073	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Associate	29901120, 30804325	★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Asthmaticus	Associate	32338995	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	35877235	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Associate	30572540	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Associate	27796151	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Associate	32588760, 35486941	★★★★★ ★☆☆☆☆ Found in Text Mining only
Trachoma	Associate	20937763	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberculosis	Stimulate	24987031	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	26503215, 30816487	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Stimulate	34517533	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervicitis	Associate	30696738	★★★★★ ★☆☆☆☆ Found in Text Mining only

CXCL5 (C-X-C motif chemokine ligand 5)