CCL24 (C-C motif chemokine ligand 24)

Gene

• Entrez ID: 6369
• Gene name: C-C motif chemokine ligand 24
• Gene symbol: CCL24
• Synonyms (NCBI Gene): Ckb-6, MPIF-2, MPIF2, SCYA24
• Chromosome: 7
• Chromosome location: 7q11.23
• Summary: This gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017589	hsa-miR-335-5p	Microarray	18185580

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IDA	19525930
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	28381538
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	9104803
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	TAS	9104803
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	TAS	10713092
GO:0007010	Process	Cytoskeleton organization	IDA	10072545
GO:0007165	Process	Signal transduction	TAS	9104803
GO:0007267	Process	Cell-cell signaling	TAS	9104803
GO:0008009	Function	Chemokine activity	IBA
GO:0008009	Function	Chemokine activity	IDA	10072545
GO:0008009	Function	Chemokine activity	IEA
GO:0008009	Function	Chemokine activity	TAS	9104803
GO:0008360	Process	Regulation of cell shape	IDA	10072545
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0030335	Process	Positive regulation of cell migration	IDA	19525930
GO:0030838	Process	Positive regulation of actin filament polymerization	IDA	19525930
GO:0031728	Function	CCR3 chemokine receptor binding	IDA	11425309
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0048018	Function	Receptor ligand activity	IDA	11425309
GO:0048020	Function	CCR chemokine receptor binding	IBA
GO:0048245	Process	Eosinophil chemotaxis	IBA
GO:0048245	Process	Eosinophil chemotaxis	IDA	10072545
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA
GO:0070098	Process	Chemokine-mediated signaling pathway	IDA	19525930
GO:2000418	Process	Positive regulation of eosinophil migration	IEA

Other IDs

• MIM: 602495
• HGNC: 10623
• e!Ensembl: ENSG00000106178

Protein

• UniProt ID: O00175
• Protein name: C-C motif chemokine 24 (CK-beta-6) (Eosinophil chemotactic protein 2) (Eotaxin-2) (Myeloid progenitor inhibitory factor 2) (MPIF-2) (Small-inducible cytokine A24)
• Protein function: Chemotactic for resting T-lymphocytes, and eosinophils (PubMed:9104803, PubMed:9365122). Has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes (PubMed:9104803, PubMed:9365122). Is a strong suppressor of
• PDB: 1EIG, 1EIH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00048	IL8	31 → 89	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

• Tissue specificity: TISSUE SPECIFICITY: Activated monocytes and activated T lymphocytes. {ECO:0000269|PubMed:9104803}.
• Sequence:

  MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLK
  AGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC

• Sequence length: 119

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway