CCL24 (C-C motif chemokine ligand 24)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6369
Gene name Gene Name - the full gene name approved by the HGNC.
C-C motif chemokine ligand 24
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CCL24
Synonyms (NCBI Gene) Gene synonyms aliases
Ckb-6, MPIF-2, MPIF2, SCYA24
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q11.23
Summary Summary of gene provided in NCBI Entrez Gene.
This gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
miRTarBase ID miRNA Experiments Reference
MIRT017589 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(36)
GO ID Ontology Definition Evidence Reference
GO:0001938 Process Positive regulation of endothelial cell proliferation IDA 19525930
GO:0005125 Function Cytokine activity IEA
GO:0005515 Function Protein binding IPI 28381538
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
602495 10623 ENSG00000106178
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O00175
Protein name C-C motif chemokine 24 (CK-beta-6) (Eosinophil chemotactic protein 2) (Eotaxin-2) (Myeloid progenitor inhibitory factor 2) (MPIF-2) (Small-inducible cytokine A24)
Protein function Chemotactic for resting T-lymphocytes, and eosinophils (PubMed:9104803, PubMed:9365122). Has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes (PubMed:9104803, PubMed:9365122). Is a strong suppressor of
PDB 1EIG , 1EIH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8 31 → 89 Small cytokines (intecrine/chemokine), interleukin-8 like Domain
Tissue specificity TISSUE SPECIFICITY: Activated monocytes and activated T lymphocytes. {ECO:0000269|PubMed:9104803}.
Sequence 
MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLK
AGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
Sequence length 119
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway 		 
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Sarcoidosis Sarcoidosis N/A N/A GWAS
Show/Hide Text Mining Associations (37)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 34724890
Allergic Fungal Sinusitis Stimulate 27717558
Asthma Stimulate 19017877, 23015684, 30658649
Bipolar Disorder Stimulate 24618828
Breast Neoplasms Associate 35725915
Carcinoma Adenoid Cystic Stimulate 30197422
Clinical Deterioration Stimulate 25997515
Cold Injury Stimulate 30385348
Colitis Ulcerative Stimulate 21077277
Conjunctivitis Allergic Stimulate 26989694