CCL23 (C-C motif chemokine ligand 23)

Gene

• Entrez ID: 6368
• Gene name: C-C motif chemokine ligand 23
• Gene symbol: CCL23
• Synonyms (NCBI Gene): CK-BETA-8, CKb8, Ckb-8, Ckb-8-1, MIP-3, MIP3, MPIF-1, SCYA23, hmrp-2a
• Chromosome: 17
• Chromosome location: 17q12
• Summary: This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002548	Process	Monocyte chemotaxis	IC	10660125
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	TAS	9886417
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	9104803
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	TAS	9104803
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	TAS	9104803
GO:0007165	Process	Signal transduction	NAS	9886417
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	9886417
GO:0007267	Process	Cell-cell signaling	TAS	9104803
GO:0008009	Function	Chemokine activity	IBA
GO:0008009	Function	Chemokine activity	IDA	10660125
GO:0008009	Function	Chemokine activity	IEA
GO:0008009	Function	Chemokine activity	TAS	9886417
GO:0008201	Function	Heparin binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	9104803
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0031726	Function	CCR1 chemokine receptor binding	IPI	10660125
GO:0048020	Function	CCR chemokine receptor binding	IBA
GO:0060326	Process	Cell chemotaxis	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA

Other IDs

• MIM: 602494
• HGNC: 10622
• e!Ensembl: ENSG00000274736

Protein

• UniProt ID: P55773
• Protein name: C-C motif chemokine 23 (CK-beta-8) (CKB-8) (Macrophage inflammatory protein 3) (MIP-3) (Myeloid progenitor inhibitory factor 1) (MPIF-1) (Small-inducible cytokine A23) [Cleaved into: CCL23(19-99); CCL23(22-99); CCL23(27-99); CCL23(30-99)]
• Protein function: Shows chemotactic activity for monocytes, resting T-lymphocytes, and neutrophils, but not for activated lymphocytes. Inhibits proliferation of myeloid progenitor cells in colony formation assays. This protein can bind heparin. Binds CCR1. CCL23(
• PDB: 1G91
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00048	IL8	52 → 109	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

• Tissue specificity: TISSUE SPECIFICITY: High levels in adult lung, liver, skeletal muscle and pancreas. Moderate levels in fetal liver, adult bone marrow and placenta. The short form is the major species and the longer form was detected only in very low abundance. CCL23(19-9
• Sequence:

  MKVSVAALSCLMLVTALGSQARVTKDAETEFMMSKLPLENPVLLDRFHATSADCCISYTP
  RSIPCSLLESYFETNSECSKPGVIFLTKKGRRFCANPSDKQVQVCVRMLKLDTRIKTRKN
  

• Sequence length: 120

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway

Reactome:

G alpha (q) signalling events
G alpha (i) signalling events
Formyl peptide receptors bind formyl peptides and many other ligands