CCL21 (C-C motif chemokine ligand 21)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 6366
Gene name C-C motif chemokine ligand 21
Gene symbol CCL21
Synonyms (NCBI Gene)
6CkineCKb9ECLSCYA21SLCTCA4
Chromosome 9
Chromosome location 9p13.3
Summary This antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adj
miRNA miRNA information provided by mirtarbase database.
21
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (21)
miRTarBase ID miRNA Experiments Reference
MIRT870952 hsa-miR-3150a-3p CLIP-seq
MIRT870953 hsa-miR-3175 CLIP-seq
MIRT870954 hsa-miR-342-5p CLIP-seq
MIRT870955 hsa-miR-3682-3p CLIP-seq
MIRT870956 hsa-miR-4502 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (2)
Transcription factor Regulation Reference
NFKB2 Activation 20953353
RELB Activation 20953353
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
66
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (66)
GO ID Ontology Definition Evidence Reference
GO:0001768 Process Establishment of T cell polarity IDA 12729902
GO:0001771 Process Immunological synapse formation ISS
GO:0001954 Process Positive regulation of cell-matrix adhesion IDA 15569314, 18308860
GO:0002407 Process Dendritic cell chemotaxis IDA 15778365
GO:0002606 Process Positive regulation of dendritic cell antigen processing and presentation ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
602737 10620 ENSG00000137077
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O00585
Protein name C-C motif chemokine 21 (6Ckine) (Beta-chemokine exodus-2) (Secondary lymphoid-tissue chemokine) (SLC) (Small-inducible cytokine A21)
Protein function Inhibits hemopoiesis and stimulates chemotaxis. Chemotactic in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Shows preferential activity towards naive T-cells. May play a role in mediating homing o
PDB 2L4N , 5EKI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8 29 → 90 Small cytokines (intecrine/chemokine), interleukin-8 like Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in high endothelial venules of lymph nodes, spleen and appendix. Intermediate levels found in small intestine, thyroid gland and trachea. Low level expression in thymus, bone marrow, liver, and pancreas. Also found in
Sequence 
MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIP
AILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSK
GCKRTERSQTPKGP
Sequence length 134
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
NF-kappa B signaling pathway 		  Chemokine receptors bind chemokines
G alpha (i) signalling events
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
11
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (11)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ANKYLOSING SPONDYLITIS — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID — CTD
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST CANCER — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (109)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Adenocarcinoma Associate 32509861
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of Lung Inhibit 39516747
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenoma Associate 21249124
★★★★★
★☆☆☆☆
Found in Text Mining only
Aortic Aneurysm Familial Abdominal 1 Stimulate 25548922
★★★★★
★☆☆☆☆
Found in Text Mining only
Arthritis Associate 20461788
★★★★★
★☆☆☆☆
Found in Text Mining only
Arthritis Psoriatic Stimulate 21225692
★★★★★
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Associate 20461788, 21225692, 21452313, 22328738, 22355377, 22392503, 29482663, 32831971
★★★★★
★☆☆☆☆
Found in Text Mining only
Atherosclerosis Inhibit 22619482
★★★★★
★☆☆☆☆
Found in Text Mining only
Autoimmune Diseases Stimulate 12393410
★★★★★
★☆☆☆☆
Found in Text Mining only
Brain Neoplasms Inhibit 33878734
★★★★★
★☆☆☆☆
Found in Text Mining only