CCL21 (C-C motif chemokine ligand 21)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6366
Gene name Gene Name - the full gene name approved by the HGNC.
C-C motif chemokine ligand 21
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CCL21
Synonyms (NCBI Gene) Gene synonyms aliases
6Ckine, CKb9, ECL, SCYA21, SLC, TCA4
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adj
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(21)
miRTarBase ID miRNA Experiments Reference
MIRT870952 hsa-miR-3150a-3p CLIP-seq
MIRT870953 hsa-miR-3175 CLIP-seq
MIRT870954 hsa-miR-342-5p CLIP-seq
MIRT870955 hsa-miR-3682-3p CLIP-seq
MIRT870956 hsa-miR-4502 CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(2)
Transcription factor Regulation Reference
NFKB2 Activation 20953353
RELB Activation 20953353
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(66)
GO ID Ontology Definition Evidence Reference
GO:0001768 Process Establishment of T cell polarity IDA 12729902
GO:0001771 Process Immunological synapse formation ISS
GO:0001954 Process Positive regulation of cell-matrix adhesion IDA 15569314, 18308860
GO:0002407 Process Dendritic cell chemotaxis IDA 15778365
GO:0002606 Process Positive regulation of dendritic cell antigen processing and presentation ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
602737 10620 ENSG00000137077
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O00585
Protein name C-C motif chemokine 21 (6Ckine) (Beta-chemokine exodus-2) (Secondary lymphoid-tissue chemokine) (SLC) (Small-inducible cytokine A21)
Protein function Inhibits hemopoiesis and stimulates chemotaxis. Chemotactic in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Shows preferential activity towards naive T-cells. May play a role in mediating homing o
PDB 2L4N , 5EKI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8 29 → 90 Small cytokines (intecrine/chemokine), interleukin-8 like Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in high endothelial venules of lymph nodes, spleen and appendix. Intermediate levels found in small intestine, thyroid gland and trachea. Low level expression in thymus, bone marrow, liver, and pancreas. Also found in
Sequence 
MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIP
AILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSK
GCKRTERSQTPKGP
Sequence length 134
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
NF-kappa B signaling pathway 		  Chemokine receptors bind chemokines
G alpha (i) signalling events
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (3)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Breast cancer N/A N/A GWAS
Celiac disease Celiac disease N/A N/A GWAS
Rheumatoid arthritis Rheumatoid arthritis N/A N/A GWAS
Show/Hide Text Mining Associations (109)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 32509861
Adenocarcinoma of Lung Inhibit 39516747
Adenoma Associate 21249124
Aortic Aneurysm Familial Abdominal 1 Stimulate 25548922
Arthritis Associate 20461788
Arthritis Psoriatic Stimulate 21225692
Arthritis Rheumatoid Associate 20461788, 21225692, 21452313, 22328738, 22355377, 22392503, 29482663, 32831971
Atherosclerosis Inhibit 22619482
Autoimmune Diseases Stimulate 12393410
Brain Neoplasms Inhibit 33878734