CCL20 (C-C motif chemokine ligand 20)

Gene

• Entrez ID: 6364
• Gene name: C-C motif chemokine ligand 20
• Gene symbol: CCL20
• Synonyms (NCBI Gene): CKb4, Exodus, LARC, MIP-3-alpha, MIP-3a, MIP3A, SCYA20, ST38
• Chromosome: 2
• Chromosome location: 2q36.3
• Summary: This antimicrobial gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The pr

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006199	hsa-miR-21-5p	ELISA, Immunofluorescence, Luciferase reporter assay	22001440
MIRT006199	hsa-miR-21-5p	ELISA, Immunofluorescence, Luciferase reporter assay	22001440
MIRT006199	hsa-miR-21-5p	ELISA, Immunofluorescence, Luciferase reporter assay	22001440
MIRT006199	hsa-miR-21-5p	ELISA, Immunofluorescence, Luciferase reporter assay	22001440
MIRT006199	hsa-miR-21-5p	ELISA, Immunofluorescence, Luciferase reporter assay	22001440
MIRT006199	hsa-miR-21-5p	ELISA, Immunofluorescence, Luciferase reporter assay	22001440
MIRT017837	hsa-miR-335-5p	Microarray	18185580
MIRT006199	hsa-miR-21-5p	ELISA, Immunohistochemistry, In situ hybridization, qRT-PCR	23817679
MIRT006199	hsa-miR-21-5p	ELISA, Immunohistochemistry, In situ hybridization, qRT-PCR	23817679
MIRT737072	hsa-miR-183-5p	Western blotting, qRT-PCR	31608699
MIRT870950	hsa-miR-4720-3p	CLIP-seq
MIRT870951	hsa-miR-4804-3p	CLIP-seq
MIRT2498625	hsa-miR-1587	CLIP-seq
MIRT2498626	hsa-miR-2116	CLIP-seq
MIRT2498627	hsa-miR-3163	CLIP-seq
MIRT2498628	hsa-miR-4652-3p	CLIP-seq
MIRT2498629	hsa-miR-4674	CLIP-seq
MIRT2498630	hsa-miR-4677-5p	CLIP-seq
MIRT2498631	hsa-miR-4803	CLIP-seq
MIRT2498632	hsa-miR-635	CLIP-seq
MIRT2498627	hsa-miR-3163	CLIP-seq
MIRT2498631	hsa-miR-4803	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CEBPD	Activation	23028973
NFKB1	Unknown	19939449;22240809
RELA	Activation	11749970
RELA	Unknown	22240809

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	17703191, 18239685, 28381538
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	9038201
GO:0006935	Process	Chemotaxis	IDA	20068036
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	10438902
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	TAS	9129037
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	TAS	10521347
GO:0007165	Process	Signal transduction	TAS	9038201
GO:0007267	Process	Cell-cell signaling	TAS	9038201
GO:0008009	Function	Chemokine activity	IEA
GO:0008009	Function	Chemokine activity	TAS	10438902
GO:0019722	Process	Calcium-mediated signaling	IDA	25122636
GO:0031640	Process	Killing of cells of another organism	IDA	12949249, 19109182
GO:0031731	Function	CCR6 chemokine receptor binding	IDA	12081481, 20068036
GO:0042742	Process	Defense response to bacterium	IEA
GO:0060326	Process	Cell chemotaxis	IDA	23765988
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12949249, 19109182
GO:0072678	Process	T cell migration	ISS
GO:0072679	Process	Thymocyte migration	ISS
GO:2000406	Process	Positive regulation of T cell migration	IDA	23620790

Other IDs

• MIM: 601960
• HGNC: 10619
• e!Ensembl: ENSG00000115009

Protein

• UniProt ID: P78556
• Protein name: C-C motif chemokine 20 (Beta-chemokine exodus-1) (CC chemokine LARC) (Liver and activation-regulated chemokine) (Macrophage inflammatory protein 3 alpha) (MIP-3-alpha) (Small-inducible cytokine A20) [Cleaved into: CCL20(1-67); CCL20(1-64); CCL20(2-70)]
• Protein function: Acts as a ligand for C-C chemokine receptor CCR6. Signals through binding and activation of CCR6 and induces a strong chemotactic response and mobilization of intracellular calcium ions (PubMed:11035086, PubMed:11352563, PubMed:20068036). The li
• PDB: 1M8A, 2HCI, 2JYO, 5UR7, 6WWZ, 7T1E
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00048	IL8	30 → 89	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the seminal plasma, endometrial fluid and follicular fluid (at protein level). Expressed predominantly in the liver, lymph nodes, appendix, peripheral blood lymphocytes, and fetal lung. Low levels seen in thymus, prostate,
• Sequence:

  MCCTKSLLLAALMSVLLLHLCGESEAASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDI
  NAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM

• Sequence length: 96

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
IL-17 signaling pathway
TNF signaling pathway
Rheumatoid arthritis

Reactome:

Chemokine receptors bind chemokines
G alpha (i) signalling events
Interleukin-10 signaling