Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6363
Gene name Gene Name - the full gene name approved by the HGNC.
C-C motif chemokine ligand 19
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CCL19
Synonyms (NCBI Gene) Gene synonyms aliases
CKb11, ELC, MIP-3b, MIP3B, SCYA19
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adj
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018017 hsa-miR-335-5p Microarray 18185580
MIRT019331 hsa-miR-148b-3p Microarray 17612493
MIRT021321 hsa-miR-9-5p Microarray 17612493
MIRT870944 hsa-miR-3664-5p CLIP-seq
MIRT870945 hsa-miR-4256 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
NFKB1 Activation 20953353
NFKB1 Unknown 17182562
RELA Unknown 17182562
RELB Activation 20953353
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001768 Process Establishment of T cell polarity IDA 12729902
GO:0001771 Process Immunological synapse formation ISS
GO:0002407 Process Dendritic cell chemotaxis IDA 15778365
GO:0002408 Process Myeloid dendritic cell chemotaxis IDA 14592837
GO:0002606 Process Positive regulation of dendritic cell antigen processing and presentation ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602227 10617 ENSG00000172724
Protein
UniProt ID Q99731
Protein name C-C motif chemokine 19 (Beta-chemokine exodus-3) (CK beta-11) (Epstein-Barr virus-induced molecule 1 ligand chemokine) (EBI1 ligand chemokine) (ELC) (Macrophage inflammatory protein 3 beta) (MIP-3-beta) (Small-inducible cytokine A19)
Protein function May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid or
PDB 2MP1 , 7STA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8 27 86 Small cytokines (intecrine/chemokine), interleukin-8 like Domain
Tissue specificity TISSUE SPECIFICITY: Expressed at high levels in the lymph nodes, thymus and appendix. Intermediate levels seen in colon and trachea, while low levels found in spleen, small intestine, lung, kidney and stomach.
Sequence
MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAV
VFTTLRGRQLCAPPDQPWVERIIQRL
QRTSAKMKRRSS
Sequence length 98
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
NF-kappa B signaling pathway
  Chemokine receptors bind chemokines
G alpha (i) signalling events
Interleukin-10 signaling
<