CCL19 (C-C motif chemokine ligand 19)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6363
Gene name Gene Name - the full gene name approved by the HGNC.
C-C motif chemokine ligand 19
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CCL19
Synonyms (NCBI Gene) Gene synonyms aliases
CKb11, ELC, MIP-3b, MIP3B, SCYA19
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adj
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(13)
miRTarBase ID miRNA Experiments Reference
MIRT018017 hsa-miR-335-5p Microarray 18185580
MIRT019331 hsa-miR-148b-3p Microarray 17612493
MIRT021321 hsa-miR-9-5p Microarray 17612493
MIRT870944 hsa-miR-3664-5p CLIP-seq
MIRT870945 hsa-miR-4256 CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(4)
Transcription factor Regulation Reference
NFKB1 Activation 20953353
NFKB1 Unknown 17182562
RELA Unknown 17182562
RELB Activation 20953353
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(64)
GO ID Ontology Definition Evidence Reference
GO:0001768 Process Establishment of T cell polarity IDA 12729902
GO:0001771 Process Immunological synapse formation ISS
GO:0002407 Process Dendritic cell chemotaxis IDA 15778365
GO:0002408 Process Myeloid dendritic cell chemotaxis IDA 14592837
GO:0002548 Process Monocyte chemotaxis IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
602227 10617 ENSG00000172724
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q99731
Protein name C-C motif chemokine 19 (Beta-chemokine exodus-3) (CK beta-11) (Epstein-Barr virus-induced molecule 1 ligand chemokine) (EBI1 ligand chemokine) (ELC) (Macrophage inflammatory protein 3 beta) (MIP-3-beta) (Small-inducible cytokine A19)
Protein function May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid or
PDB 2MP1 , 7STA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8 27 → 86 Small cytokines (intecrine/chemokine), interleukin-8 like Domain
Tissue specificity TISSUE SPECIFICITY: Expressed at high levels in the lymph nodes, thymus and appendix. Intermediate levels seen in colon and trachea, while low levels found in spleen, small intestine, lung, kidney and stomach.
Sequence 
MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAV
VFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
Sequence length 98
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
NF-kappa B signaling pathway 		  Chemokine receptors bind chemokines
G alpha (i) signalling events
Interleukin-10 signaling
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Dermatitis Dermatitis, Allergic Contact rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174 17597826
Leukemia Leukemia, Myelocytic, Acute rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 27903959
Show/Hide Text Mining Associations (106)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 32509861
Adenocarcinoma of Lung Associate 23922113
Adenoma Associate 21249124
Aortic Aneurysm Familial Abdominal 1 Stimulate 25548922
Aortic Valve Stenosis Associate 36199424
Arthritis Psoriatic Stimulate 21225692
Arthritis Rheumatoid Stimulate 15331393
Arthritis Rheumatoid Associate 21225692, 28648867, 29482663
Autoimmune Diseases Associate 29379035
Breast Neoplasms Associate 21624121, 33146700, 34867821, 35550569, 36581948, 37864213, 39214479