CCL19 (C-C motif chemokine ligand 19)

Gene

• Entrez ID: 6363
• Gene name: C-C motif chemokine ligand 19
• Gene symbol: CCL19
• Synonyms (NCBI Gene): CKb11, ELC, MIP-3b, MIP3B, SCYA19
• Chromosome: 9
• Chromosome location: 9p13.3
• Summary: This antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adj

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018017	hsa-miR-335-5p	Microarray	18185580
MIRT019331	hsa-miR-148b-3p	Microarray	17612493
MIRT021321	hsa-miR-9-5p	Microarray	17612493
MIRT870944	hsa-miR-3664-5p	CLIP-seq
MIRT870945	hsa-miR-4256	CLIP-seq
MIRT870946	hsa-miR-4651	CLIP-seq
MIRT870947	hsa-miR-4714-5p	CLIP-seq
MIRT870948	hsa-miR-608	CLIP-seq
MIRT870949	hsa-miR-646	CLIP-seq
MIRT2195365	hsa-miR-329	CLIP-seq
MIRT2195366	hsa-miR-342-3p	CLIP-seq
MIRT2195367	hsa-miR-362-3p	CLIP-seq
MIRT2195368	hsa-miR-377	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Activation	20953353
NFKB1	Unknown	17182562
RELA	Unknown	17182562
RELB	Activation	20953353

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001768	Process	Establishment of T cell polarity	IDA	12729902
GO:0001771	Process	Immunological synapse formation	ISS
GO:0002407	Process	Dendritic cell chemotaxis	IDA	15778365
GO:0002408	Process	Myeloid dendritic cell chemotaxis	IDA	14592837
GO:0002606	Process	Positive regulation of dendritic cell antigen processing and presentation	ISS
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	27044744, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	TAS	9153236
GO:0006935	Process	Chemotaxis	IEA
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	NAS	14592837
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	TAS	10861057
GO:0007154	Process	Cell communication	TAS	9153236
GO:0008009	Function	Chemokine activity	IBA
GO:0008009	Function	Chemokine activity	IDA	15778365
GO:0008009	Function	Chemokine activity	IEA
GO:0009615	Process	Response to virus	TAS	9153236
GO:0010560	Process	Positive regulation of glycoprotein biosynthetic process	ISS
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0031295	Process	T cell costimulation	ISS
GO:0031640	Process	Killing of cells of another organism	IDA	12949249
GO:0031732	Function	CCR7 chemokine receptor binding	ISS
GO:0031735	Function	CCR10 chemokine receptor binding	IDA	10706668
GO:0032489	Process	Regulation of Cdc42 protein signal transduction	ISS
GO:0032731	Process	Positive regulation of interleukin-1 beta production	ISS
GO:0032735	Process	Positive regulation of interleukin-12 production	ISS
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0035022	Process	Positive regulation of Rac protein signal transduction	ISS
GO:0038119	Process	CCL19-activated CCR7 signaling pathway	IDA	14592837
GO:0042102	Process	Positive regulation of T cell proliferation	ISS
GO:0042379	Function	Chemokine receptor binding	IDA	23341447
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	15059845
GO:0045627	Process	Positive regulation of T-helper 1 cell differentiation	ISS
GO:0045807	Process	Positive regulation of endocytosis	ISS
GO:0046330	Process	Positive regulation of JNK cascade	IDA	15778365
GO:0046330	Process	Positive regulation of JNK cascade	ISS
GO:0048020	Function	CCR chemokine receptor binding	IBA
GO:0048020	Function	CCR chemokine receptor binding	IPI	20002784
GO:0048245	Process	Eosinophil chemotaxis	IBA
GO:0048260	Process	Positive regulation of receptor-mediated endocytosis	ISS
GO:0048469	Process	Cell maturation	ISS
GO:0050921	Process	Positive regulation of chemotaxis	ISS
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IDA	14592837
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	14592837, 15059845, 15778365
GO:0060491	Process	Regulation of cell projection assembly	ISS
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12949249
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	15778365
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	25754930
GO:0071380	Process	Cellular response to prostaglandin E stimulus	IDA	14592837
GO:0071731	Process	Response to nitric oxide	IDA	16249377
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IDA	21051556
GO:0097029	Process	Mature conventional dendritic cell differentiation	ISS
GO:0098586	Process	Cellular response to virus	IMP	25754930
GO:0141214	Process	Positive regulation of phospholipase C/protein kinase C signal transduction	IDA	14592837
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IDA	15059845
GO:2000147	Process	Positive regulation of cell motility	IDA	15778365
GO:2000549	Process	Positive regulation of dendritic cell dendrite assembly	ISS
GO:2000669	Process	Negative regulation of dendritic cell apoptotic process	IDA	15059845

Other IDs

• MIM: 602227
• HGNC: 10617
• e!Ensembl: ENSG00000172724

Protein

• UniProt ID: Q99731
• Protein name: C-C motif chemokine 19 (Beta-chemokine exodus-3) (CK beta-11) (Epstein-Barr virus-induced molecule 1 ligand chemokine) (EBI1 ligand chemokine) (ELC) (Macrophage inflammatory protein 3 beta) (MIP-3-beta) (Small-inducible cytokine A19)
• Protein function: May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid or
• PDB: 2MP1, 7STA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00048	IL8	27 → 86	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed at high levels in the lymph nodes, thymus and appendix. Intermediate levels seen in colon and trachea, while low levels found in spleen, small intestine, lung, kidney and stomach.
• Sequence:

  MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAV
  VFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS

• Sequence length: 98

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
NF-kappa B signaling pathway

Reactome:

Chemokine receptors bind chemokines
G alpha (i) signalling events
Interleukin-10 signaling