Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6363
Gene name Gene Name - the full gene name approved by the HGNC.	C-C motif chemokine ligand 19
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CCL19
Synonyms (NCBI Gene) Gene synonyms aliases	CKb11, ELC, MIP-3b, MIP3B, SCYA19
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9p13.3
Summary Summary of gene provided in NCBI Entrez Gene.	This antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adj

Show/Hide all(13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018017	hsa-miR-335-5p	Microarray	18185580
MIRT019331	hsa-miR-148b-3p	Microarray	17612493
MIRT021321	hsa-miR-9-5p	Microarray	17612493
MIRT870944	hsa-miR-3664-5p	CLIP-seq
MIRT870945	hsa-miR-4256	CLIP-seq
MIRT870946	hsa-miR-4651	CLIP-seq
MIRT870947	hsa-miR-4714-5p	CLIP-seq
MIRT870948	hsa-miR-608	CLIP-seq
MIRT870949	hsa-miR-646	CLIP-seq
MIRT2195365	hsa-miR-329	CLIP-seq
MIRT2195366	hsa-miR-342-3p	CLIP-seq
MIRT2195367	hsa-miR-362-3p	CLIP-seq
MIRT2195368	hsa-miR-377	CLIP-seq

Transcription factors

Show/Hide all(4)

Transcription factor	Regulation	Reference
NFKB1	Activation	20953353
NFKB1	Unknown	17182562
RELA	Unknown	17182562
RELB	Activation	20953353

Show/Hide all(66)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001768	Process	Establishment of T cell polarity	IDA	12729902
GO:0001771	Process	Immunological synapse formation	ISS
GO:0002407	Process	Dendritic cell chemotaxis	IDA	15778365
GO:0002408	Process	Myeloid dendritic cell chemotaxis	IDA	14592837
GO:0002606	Process	Positive regulation of dendritic cell antigen processing and presentation	ISS
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	27044744, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	TAS	9153236
GO:0006935	Process	Chemotaxis	IEA
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	NAS	14592837
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	TAS	10861057
GO:0007154	Process	Cell communication	TAS	9153236
GO:0008009	Function	Chemokine activity	IBA
GO:0008009	Function	Chemokine activity	IDA	15778365
GO:0008009	Function	Chemokine activity	IEA
GO:0009615	Process	Response to virus	TAS	9153236
GO:0010560	Process	Positive regulation of glycoprotein biosynthetic process	ISS
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0031295	Process	T cell costimulation	ISS
GO:0031640	Process	Killing of cells of another organism	IDA	12949249
GO:0031732	Function	CCR7 chemokine receptor binding	ISS
GO:0031735	Function	CCR10 chemokine receptor binding	IDA	10706668
GO:0032489	Process	Regulation of Cdc42 protein signal transduction	ISS
GO:0032731	Process	Positive regulation of interleukin-1 beta production	ISS
GO:0032735	Process	Positive regulation of interleukin-12 production	ISS
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0035022	Process	Positive regulation of Rac protein signal transduction	ISS
GO:0038119	Process	CCL19-activated CCR7 signaling pathway	IDA	14592837
GO:0042102	Process	Positive regulation of T cell proliferation	ISS
GO:0042379	Function	Chemokine receptor binding	IDA	23341447
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	15059845
GO:0045627	Process	Positive regulation of T-helper 1 cell differentiation	ISS
GO:0045807	Process	Positive regulation of endocytosis	ISS
GO:0046330	Process	Positive regulation of JNK cascade	IDA	15778365
GO:0046330	Process	Positive regulation of JNK cascade	ISS
GO:0048020	Function	CCR chemokine receptor binding	IBA
GO:0048020	Function	CCR chemokine receptor binding	IPI	20002784
GO:0048245	Process	Eosinophil chemotaxis	IBA
GO:0048260	Process	Positive regulation of receptor-mediated endocytosis	ISS
GO:0048469	Process	Cell maturation	ISS
GO:0050921	Process	Positive regulation of chemotaxis	ISS
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IDA	14592837
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	14592837, 15059845, 15778365
GO:0060491	Process	Regulation of cell projection assembly	ISS
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12949249
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	15778365
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	25754930
GO:0071380	Process	Cellular response to prostaglandin E stimulus	IDA	14592837
GO:0071731	Process	Response to nitric oxide	IDA	16249377
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IDA	21051556
GO:0097029	Process	Mature conventional dendritic cell differentiation	ISS
GO:0098586	Process	Cellular response to virus	IMP	25754930
GO:0141214	Process	Positive regulation of phospholipase C/protein kinase C signal transduction	IDA	14592837
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IDA	15059845
GO:2000147	Process	Positive regulation of cell motility	IDA	15778365
GO:2000549	Process	Positive regulation of dendritic cell dendrite assembly	ISS
GO:2000669	Process	Negative regulation of dendritic cell apoptotic process	IDA	15059845

MIM	HGNC	e!Ensembl
602227	10617	ENSG00000172724

Protein

UniProt ID

Q99731

Protein name

C-C motif chemokine 19 (Beta-chemokine exodus-3) (CK beta-11) (Epstein-Barr virus-induced molecule 1 ligand chemokine) (EBI1 ligand chemokine) (ELC) (Macrophage inflammatory protein 3 beta) (MIP-3-beta) (Small-inducible cytokine A19)

Protein function

May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid or

PDB

2MP1 , 7STA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00048	IL8	27 → 86	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed at high levels in the lymph nodes, thymus and appendix. Intermediate levels seen in colon and trachea, while low levels found in spleen, small intestine, lung, kidney and stomach.

Sequence

MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAV
VFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor Chemokine signaling pathway NF-kappa B signaling pathway		Chemokine receptors bind chemokines G alpha (i) signalling events Interleukin-10 signaling

CCL19 (C-C motif chemokine ligand 19)