Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6362
Gene name Gene Name - the full gene name approved by the HGNC.	C-C motif chemokine ligand 18
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CCL18
Synonyms (NCBI Gene) Gene synonyms aliases	AMAC-1, AMAC1, CKb7, DC-CK1, DCCK1, MIP-4, PARC, SCYA18
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q12
Summary Summary of gene provided in NCBI Entrez Gene.	This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized

Show/Hide all(7)

miRTarBase ID	miRNA	Experiments
MIRT870937	hsa-miR-346	CLIP-seq
MIRT870938	hsa-miR-4251	CLIP-seq
MIRT870939	hsa-miR-4288	CLIP-seq
MIRT870940	hsa-miR-4663	CLIP-seq
MIRT870941	hsa-miR-539	CLIP-seq
MIRT870942	hsa-miR-632	CLIP-seq
MIRT870943	hsa-miR-654-3p	CLIP-seq

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	21481794
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	9192897
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	TAS	9192897
GO:0007154	Process	Cell communication	TAS	9192897
GO:0007165	Process	Signal transduction	TAS	9233607
GO:0007267	Process	Cell-cell signaling	TAS	9233607
GO:0008009	Function	Chemokine activity	IBA
GO:0008009	Function	Chemokine activity	IEA
GO:0008009	Function	Chemokine activity	TAS	9192897
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0031640	Process	Killing of cells of another organism	IDA	12949249
GO:0048020	Function	CCR chemokine receptor binding	IBA
GO:0060326	Process	Cell chemotaxis	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12949249
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA

MIM	HGNC	e!Ensembl
603757	10616	ENSG00000275385

Protein

UniProt ID

P55774

Protein name

C-C motif chemokine 18 (Alternative macrophage activation-associated CC chemokine 1) (AMAC-1) (CC chemokine PARC) (Dendritic cell chemokine 1) (DC-CK1) (Macrophage inflammatory protein 4) (MIP-4) (Pulmonary and activation-regulated chemokine) (Small-induc

Protein function

Chemotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved in B-cell migration into B-cell follicles in lymph nodes. Attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph node

PDB

4MHE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00048	IL8	28 → 85	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed at high levels in lung, lymph nodes, placenta, bone marrow, dendritic cells present in germinal centers and T-cell areas of secondary lymphoid organs and macrophages derived from peripheral blood monocytes. Not expressed by p

Sequence

MKGLAAALLVLVCTMALCSCAQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVI
LLTKRGRQICADPNKKWVQKYISDLKLNA

Sequence length

Interactions

View interactions

	KEGG
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor Chemokine signaling pathway

CCL18 (C-C motif chemokine ligand 18)