CCL18 (C-C motif chemokine ligand 18)

Gene

• Entrez ID: 6362
• Gene name: C-C motif chemokine ligand 18
• Gene symbol: CCL18
• Synonyms (NCBI Gene): AMAC-1, AMAC1, CKb7, DC-CK1, DCCK1, MIP-4, PARC, SCYA18
• Chromosome: 17
• Chromosome location: 17q12
• Summary: This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT870937	hsa-miR-346	CLIP-seq
MIRT870938	hsa-miR-4251	CLIP-seq
MIRT870939	hsa-miR-4288	CLIP-seq
MIRT870940	hsa-miR-4663	CLIP-seq
MIRT870941	hsa-miR-539	CLIP-seq
MIRT870942	hsa-miR-632	CLIP-seq
MIRT870943	hsa-miR-654-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	21481794
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	9192897
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	TAS	9192897
GO:0007154	Process	Cell communication	TAS	9192897
GO:0007165	Process	Signal transduction	TAS	9233607
GO:0007267	Process	Cell-cell signaling	TAS	9233607
GO:0008009	Function	Chemokine activity	IBA
GO:0008009	Function	Chemokine activity	IEA
GO:0008009	Function	Chemokine activity	TAS	9192897
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0031640	Process	Killing of cells of another organism	IDA	12949249
GO:0048020	Function	CCR chemokine receptor binding	IBA
GO:0060326	Process	Cell chemotaxis	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12949249
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA

Other IDs

• MIM: 603757
• HGNC: 10616
• e!Ensembl: ENSG00000275385

Protein

• UniProt ID: P55774
• Protein name: C-C motif chemokine 18 (Alternative macrophage activation-associated CC chemokine 1) (AMAC-1) (CC chemokine PARC) (Dendritic cell chemokine 1) (DC-CK1) (Macrophage inflammatory protein 4) (MIP-4) (Pulmonary and activation-regulated chemokine) (Small-induc
• Protein function: Chemotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved in B-cell migration into B-cell follicles in lymph nodes. Attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph node
• PDB: 4MHE
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00048	IL8	28 → 85	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed at high levels in lung, lymph nodes, placenta, bone marrow, dendritic cells present in germinal centers and T-cell areas of secondary lymphoid organs and macrophages derived from peripheral blood monocytes. Not expressed by p
• Sequence:

  MKGLAAALLVLVCTMALCSCAQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVI
  LLTKRGRQICADPNKKWVQKYISDLKLNA

• Sequence length: 89

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway