Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	636
Gene name Gene Name - the full gene name approved by the HGNC.	BICD cargo adaptor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	BICD1
Synonyms (NCBI Gene) Gene synonyms aliases	BICD, bic-D 1
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12p11.21
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes an adaptor protein that belongs to the bicaudal D family of dynein cargo adaptors. The encoded protein acts as an intracellular cargo transport cofactor that regulates the microtubule-based loading of cargo onto the dynein motor complex.

Show/Hide all(25)

miRTarBase ID	miRNA	Experiments	Reference
MIRT026457	hsa-miR-192-5p	Microarray	19074876
MIRT045284	hsa-miR-186-5p	CLASH	23622248
MIRT821368	hsa-miR-142-5p	CLIP-seq
MIRT821369	hsa-miR-3146	CLIP-seq
MIRT821370	hsa-miR-3646	CLIP-seq
MIRT821371	hsa-miR-513a-3p	CLIP-seq
MIRT821372	hsa-miR-548a-5p	CLIP-seq
MIRT821373	hsa-miR-548ab	CLIP-seq
MIRT821374	hsa-miR-548ak	CLIP-seq
MIRT821375	hsa-miR-548b-5p	CLIP-seq
MIRT821376	hsa-miR-548c-5p	CLIP-seq
MIRT821377	hsa-miR-548d-5p	CLIP-seq
MIRT821378	hsa-miR-548h	CLIP-seq
MIRT821379	hsa-miR-548i	CLIP-seq
MIRT821380	hsa-miR-548j	CLIP-seq
MIRT821381	hsa-miR-548k	CLIP-seq
MIRT821382	hsa-miR-548l	CLIP-seq
MIRT821383	hsa-miR-548p	CLIP-seq
MIRT821384	hsa-miR-548w	CLIP-seq
MIRT821385	hsa-miR-548y	CLIP-seq
MIRT821386	hsa-miR-559	CLIP-seq
MIRT1942808	hsa-miR-143	CLIP-seq
MIRT821370	hsa-miR-3646	CLIP-seq
MIRT1942809	hsa-miR-4768-3p	CLIP-seq
MIRT1942810	hsa-miR-4770	CLIP-seq

Show/Hide all(48)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005200	Function	Structural constituent of cytoskeleton	TAS	9367685
GO:0005515	Function	Protein binding	IPI	17139249, 20089649, 21988832
GO:0005794	Component	Golgi apparatus	IBA	21873635
GO:0005794	Component	Golgi apparatus	IDA	17562788
GO:0005794	Component	Golgi apparatus	IDA	17139249
GO:0005802	Component	Trans-Golgi network	IDA	12447383, 20089649
GO:0005813	Component	Centrosome	IMP	17139249
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA	12447383
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	NAS	9367685
GO:0005881	Component	Cytoplasmic microtubule	IDA	20089649
GO:0006396	Process	RNA processing	TAS	9367685
GO:0008093	Function	Cytoskeletal anchor activity	IBA	21873635
GO:0008093	Function	Cytoskeletal anchor activity	IDA	12447383
GO:0008298	Process	Intracellular mRNA localization	NAS	9367685
GO:0009653	Process	Anatomical structure morphogenesis	TAS	9367685
GO:0016020	Component	Membrane	IDA	12447383
GO:0016032	Process	Viral process	IMP	20089649
GO:0019901	Function	Protein kinase binding	IPI	17139249
GO:0031267	Function	Small GTPase binding	IPI	12447383
GO:0031410	Component	Cytoplasmic vesicle	IDA	12447383, 20089649
GO:0031871	Function	Proteinase activated receptor binding	ISS	20164183
GO:0033365	Process	Protein localization to organelle	IBA	21873635
GO:0033365	Process	Protein localization to organelle	IDA	12447383, 20089649
GO:0034063	Process	Stress granule assembly	ISS
GO:0034452	Function	Dynactin binding	IBA	21873635
GO:0034452	Function	Dynactin binding	IDA	12447383
GO:0034452	Function	Dynactin binding	IPI	17139249
GO:0045298	Component	Tubulin complex	TAS	20164183
GO:0045505	Function	Dynein intermediate chain binding	IBA	21873635
GO:0045505	Function	Dynein intermediate chain binding	IDA	17139249
GO:0048260	Process	Positive regulation of receptor-mediated endocytosis	IBA	21873635
GO:0048260	Process	Positive regulation of receptor-mediated endocytosis	IMP	20164183
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	20089649
GO:0048471	Component	Perinuclear region of cytoplasm	IMP	17139249
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IBA	21873635
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IGI	17139249
GO:0070840	Function	Dynein complex binding	IBA	21873635
GO:0070840	Function	Dynein complex binding	IDA	12447383
GO:0072385	Process	Minus-end-directed organelle transport along microtubule	IMP	12447383
GO:0072393	Process	Microtubule anchoring at microtubule organizing center	IBA	21873635
GO:0072393	Process	Microtubule anchoring at microtubule organizing center	ISS	19825938
GO:0099503	Component	Secretory vesicle	IDA	20089649
GO:1900275	Process	Negative regulation of phospholipase C activity	ISS
GO:1900276	Process	Regulation of proteinase activated receptor activity	ISS
GO:1900737	Process	Negative regulation of phospholipase C-activating G protein-coupled receptor signaling pathway	ISS
GO:1904781	Process	Positive regulation of protein localization to centrosome	IGI	17139249

MIM	HGNC	e!Ensembl
602204	1049	ENSG00000151746

Protein

UniProt ID

Q96G01

Protein name

Protein bicaudal D homolog 1 (Bic-D 1)

Protein function

Regulates coat complex coatomer protein I (COPI)-independent Golgi-endoplasmic reticulum transport by recruiting the dynein-dynactin motor complex.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09730	BicD	74 → 799	Microtubule-associated protein Bicaudal-D	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Expressed in the brain, heart and skeletal muscle.

Sequence

MAAEEVLQTVDHYKTEIERLTKELTETTHEKIQAAEYGLVVLEEKLTLKQQYDELEAEYD
SLKQELEQLKEAFGQSFSIHRKVAEDGETREETLLQESASKEAYYLGKILEMQNELKQSR
AVVTNVQAENERLTAVVQDLKENNEMVELQRIRMKDEIREYKFREARLLQDYTELEEENI
TLQKLVSTLKQNQVEYEGLKHEIKRFEEETVLLNSQLEDAIRLKEIAEHQLEEALETLKN
EREQKNNLRKELSQYISLNDNHISISVDGLKFAEDGSEPNNDDKMNGHIHGPLVKLNGDY
RTPTLRKGESLNPVSDLFSELNISEIQKLKQQLMQVEREKAILLANLQESQTQLEHTKGA
LTEQHERVHRLTEHVNAMRGLQSSKELKAELDGEKGRDSGEEAHDYEVDINGLEILECKY
RVAVTEVIDLKAEIKALKEKYNKSVENYTDEKAKYESKIQMYDEQVTSLEKTTKESGEKM
AHMEKELQKMTSIANENHSTLNTAQDELVTFSEELAQLYHHVCLCNNETPNRVMLDYYRQ
SRVTRSGSLKGPDDPRGLLSPRLARRGVSSPVETRTSSEPVAKESTEASKEPSPTKTPTI
SPVITAPPSSPVLDTSDIRKEPMNIYNLNAIIRDQIKHLQKAVDRSLQLSRQRAAARELA
PMIDKDKEALMEEILKLKSLLSTKREQIATLRAVLKANKQTAEVALANLKNKYENEKAMV
TETMTKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNTLL
RMAIQQKLALTQRLEDLEFDHEQSRRSKGKLGKSKIGSPKVSGEASVTVPTIDTYLLHSQ
GPQTPNIRVSSGTQRKRQFSPSLCDQSRPRTSGASYLQNLLRVPPDPTSTESFLLKGPPS
MSEFIQGHRLSKEKRLTVAPPDCQQPAASVPPQCSQLAGRQDCPTVSPDTALPEEQPHSS
SQCAPLHCLSKPPHP

Sequence length

975

Interactions

View interactions

	KEGG		Reactome
	Viral life cycle - HIV-1		COPI-independent Golgi-to-ER retrograde traffic

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Pancreatic cancer	Malignant neoplasm of pancreas	rs118203998, rs180177143, rs587776417, rs587776527, rs864622498, rs876659571, rs587778587, rs886039619, rs745533713, rs1555460431	20686608

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Dementia	Dementia			GWAS

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References
Associations from Text Mining
Aortic Aneurysm Thoracic	Associate	29538353
Coronary Disease	Associate	36221106
Emphysema	Associate	20709820, 25154699
Hearing Loss	Associate	37240244
Peripheral Nervous System Diseases	Associate	37240244
Pulmonary Disease Chronic Obstructive	Associate	20709820, 32234053
Renal cell carcinoma 1	Associate	25154699

BICD1 (BICD cargo adaptor 1)