BICD1 (BICD cargo adaptor 1)

Gene

• Entrez ID: 636
• Gene name: BICD cargo adaptor 1
• Gene symbol: BICD1
• Synonyms (NCBI Gene): BICD, bic-D 1
• Chromosome: 12
• Chromosome location: 12p11.21
• Summary: This gene encodes an adaptor protein that belongs to the bicaudal D family of dynein cargo adaptors. The encoded protein acts as an intracellular cargo transport cofactor that regulates the microtubule-based loading of cargo onto the dynein motor complex.

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT026457	hsa-miR-192-5p	Microarray	19074876
MIRT045284	hsa-miR-186-5p	CLASH	23622248
MIRT821368	hsa-miR-142-5p	CLIP-seq
MIRT821369	hsa-miR-3146	CLIP-seq
MIRT821370	hsa-miR-3646	CLIP-seq
MIRT821371	hsa-miR-513a-3p	CLIP-seq
MIRT821372	hsa-miR-548a-5p	CLIP-seq
MIRT821373	hsa-miR-548ab	CLIP-seq
MIRT821374	hsa-miR-548ak	CLIP-seq
MIRT821375	hsa-miR-548b-5p	CLIP-seq
MIRT821376	hsa-miR-548c-5p	CLIP-seq
MIRT821377	hsa-miR-548d-5p	CLIP-seq
MIRT821378	hsa-miR-548h	CLIP-seq
MIRT821379	hsa-miR-548i	CLIP-seq
MIRT821380	hsa-miR-548j	CLIP-seq
MIRT821381	hsa-miR-548k	CLIP-seq
MIRT821382	hsa-miR-548l	CLIP-seq
MIRT821383	hsa-miR-548p	CLIP-seq
MIRT821384	hsa-miR-548w	CLIP-seq
MIRT821385	hsa-miR-548y	CLIP-seq
MIRT821386	hsa-miR-559	CLIP-seq
MIRT1942808	hsa-miR-143	CLIP-seq
MIRT821370	hsa-miR-3646	CLIP-seq
MIRT1942809	hsa-miR-4768-3p	CLIP-seq
MIRT1942810	hsa-miR-4770	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005200	Function	Structural constituent of cytoskeleton	TAS	9367685
GO:0005515	Function	Protein binding	IPI	17139249, 20089649, 21988832, 32079660
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IDA	17139249
GO:0005794	Component	Golgi apparatus	IDA	17562788
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IDA	12447383, 20089649
GO:0005813	Component	Centrosome	IMP	17139249
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	12447383
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	NAS	9367685
GO:0005881	Component	Cytoplasmic microtubule	IDA	20089649
GO:0006396	Process	RNA processing	TAS	9367685
GO:0008093	Function	Cytoskeletal anchor activity	IBA
GO:0008093	Function	Cytoskeletal anchor activity	IDA	12447383
GO:0008093	Function	Cytoskeletal anchor activity	IEA
GO:0008298	Process	Intracellular mRNA localization	NAS	9367685
GO:0009653	Process	Anatomical structure morphogenesis	TAS	9367685
GO:0016020	Component	Membrane	IDA	12447383
GO:0019068	Process	Virion assembly	IMP	20089649
GO:0019901	Function	Protein kinase binding	IPI	17139249
GO:0031267	Function	Small GTPase binding	IPI	12447383
GO:0031410	Component	Cytoplasmic vesicle	IDA	12447383, 20089649
GO:0031871	Function	Proteinase activated receptor binding	ISS	20164183
GO:0033365	Process	Protein localization to organelle	IBA
GO:0034063	Process	Stress granule assembly	ISS
GO:0034452	Function	Dynactin binding	IBA
GO:0034452	Function	Dynactin binding	IDA	12447383
GO:0034452	Function	Dynactin binding	IPI	17139249
GO:0045054	Process	Constitutive secretory pathway	TAS	20089649
GO:0045505	Function	Dynein intermediate chain binding	IBA
GO:0045505	Function	Dynein intermediate chain binding	IDA	17139249
GO:0048260	Process	Positive regulation of receptor-mediated endocytosis	IBA
GO:0048260	Process	Positive regulation of receptor-mediated endocytosis	IMP	20164183
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	20089649
GO:0048471	Component	Perinuclear region of cytoplasm	IMP	17139249
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IBA
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IGI	17139249
GO:0070840	Function	Dynein complex binding	IBA
GO:0070840	Function	Dynein complex binding	IDA	12447383
GO:0070840	Function	Dynein complex binding	IEA
GO:0072385	Process	Minus-end-directed organelle transport along microtubule	IMP	12447383
GO:0072393	Process	Microtubule anchoring at microtubule organizing center	IBA
GO:0072393	Process	Microtubule anchoring at microtubule organizing center	ISS	19825938
GO:0099503	Component	Secretory vesicle	IDA	20089649
GO:1900737	Process	Negative regulation of phospholipase C-activating G protein-coupled receptor signaling pathway	ISS
GO:1904781	Process	Positive regulation of protein localization to centrosome	IGI	17139249

Other IDs

• MIM: 602204
• HGNC: 1049
• e!Ensembl: ENSG00000151746

Protein

• UniProt ID: Q96G01
• Protein name: Protein bicaudal D homolog 1 (Bic-D 1)
• Protein function: Regulates coat complex coatomer protein I (COPI)-independent Golgi-endoplasmic reticulum transport by recruiting the dynein-dynactin motor complex.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF09730	BicD	74 → 799	Microtubule-associated protein Bicaudal-D	Coiled-coil

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the brain, heart and skeletal muscle.
• Sequence:

  MAAEEVLQTVDHYKTEIERLTKELTETTHEKIQAAEYGLVVLEEKLTLKQQYDELEAEYD
  SLKQELEQLKEAFGQSFSIHRKVAEDGETREETLLQESASKEAYYLGKILEMQNELKQSR
  AVVTNVQAENERLTAVVQDLKENNEMVELQRIRMKDEIREYKFREARLLQDYTELEEENI
  TLQKLVSTLKQNQVEYEGLKHEIKRFEEETVLLNSQLEDAIRLKEIAEHQLEEALETLKN
  EREQKNNLRKELSQYISLNDNHISISVDGLKFAEDGSEPNNDDKMNGHIHGPLVKLNGDY
  RTPTLRKGESLNPVSDLFSELNISEIQKLKQQLMQVEREKAILLANLQESQTQLEHTKGA
  LTEQHERVHRLTEHVNAMRGLQSSKELKAELDGEKGRDSGEEAHDYEVDINGLEILECKY
  RVAVTEVIDLKAEIKALKEKYNKSVENYTDEKAKYESKIQMYDEQVTSLEKTTKESGEKM
  AHMEKELQKMTSIANENHSTLNTAQDELVTFSEELAQLYHHVCLCNNETPNRVMLDYYRQ
  SRVTRSGSLKGPDDPRGLLSPRLARRGVSSPVETRTSSEPVAKESTEASKEPSPTKTPTI
  SPVITAPPSSPVLDTSDIRKEPMNIYNLNAIIRDQIKHLQKAVDRSLQLSRQRAAARELA
  PMIDKDKEALMEEILKLKSLLSTKREQIATLRAVLKANKQTAEVALANLKNKYENEKAMV
  TETMTKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNTLL
  RMAIQQKLALTQRLEDLEFDHEQSRRSKGKLGKSKIGSPKVSGEASVTVPTIDTYLLHSQ
  GPQTPNIRVSSGTQRKRQFSPSLCDQSRPRTSGASYLQNLLRVPPDPTSTESFLLKGPPS
  MSEFIQGHRLSKEKRLTVAPPDCQQPAASVPPQCSQLAGRQDCPTVSPDTALPEEQPHSS
  SQCAPLHCLSKPPHP

• Sequence length: 975

Pathways

KEGG:

Viral life cycle - HIV-1

Reactome:

COPI-independent Golgi-to-ER retrograde traffic