CCL11 (C-C motif chemokine ligand 11)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6356
Gene name Gene Name - the full gene name approved by the HGNC.
C-C motif chemokine ligand 11
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CCL11
Synonyms (NCBI Gene) Gene synonyms aliases
SCYA11
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q12
Summary Summary of gene provided in NCBI Entrez Gene.
This antimicrobial gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(49)
miRTarBase ID miRNA Experiments Reference
MIRT019315 hsa-miR-148b-3p Microarray 17612493
MIRT564003 hsa-miR-1277-5p PAR-CLIP 20371350
MIRT564002 hsa-miR-5011-5p PAR-CLIP 20371350
MIRT564001 hsa-miR-190a-3p PAR-CLIP 20371350
MIRT459497 hsa-miR-6758-5p PAR-CLIP 23592263
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(9)
Transcription factor Regulation Reference
NFKB1 Activation 16604092
NFKB1 Unknown 10586089;11076795;14660485
RELA Activation 16604092
RELA Unknown 10586089;11076795;14660485
STAT3 Activation 19265112
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(53)
GO ID Ontology Definition Evidence Reference
GO:0001938 Process Positive regulation of endothelial cell proliferation IDA 19525930
GO:0002544 Process Chronic inflammatory response IEA
GO:0002551 Process Mast cell chemotaxis IEA
GO:0005125 Function Cytokine activity IEA
GO:0005515 Function Protein binding IPI 18275857, 21314817, 23597562, 28381538
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
601156 10610 ENSG00000172156
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P51671
Protein name Eotaxin (C-C motif chemokine 11) (Eosinophil chemotactic protein) (Small-inducible cytokine A11)
Protein function In response to the presence of allergens, this protein directly promotes the accumulation of eosinophils, a prominent feature of allergic inflammatory reactions (PubMed:8597956). Binds to CCR3 (PubMed:8631813). {ECO:0000269|PubMed:8597956, ECO:0
PDB 1EOT , 2EOT , 2MPM , 7SCS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8 30 → 88 Small cytokines (intecrine/chemokine), interleukin-8 like Domain
Sequence 
MKVSAALLWLLLIAAAFSPQGLAGPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQK
AVIFKTKLAKDICADPKKKWVQDSMKYLDQKSPTPKP
Sequence length 97
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
IL-17 signaling pathway
Asthma 		  Chemokine receptors bind chemokines
Interleukin-4 and Interleukin-13 signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Inflammatory Bowel Disease Inflammatory bowel disease (MTAG) N/A N/A GWAS
Show/Hide Text Mining Associations (156)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acquired Immunodeficiency Syndrome Associate 11501668
Acute Febrile Encephalopathy Associate 22012040
adult multisystem inflammatory disease COVID 19 related Associate 36102684
Allergic Fungal Sinusitis Associate 25624129, 26047816
Alzheimer Disease Associate 26324103
Anastomotic Leak Stimulate 35652588
Aneurysm Associate 23887838
Aortic Aneurysm Abdominal Associate 27126477
Aphasia Primary Progressive Associate 34602080
Arthritis Psoriatic Associate 40149440