CCL8 (C-C motif chemokine ligand 8)

Gene

• Entrez ID: 6355
• Gene name: C-C motif chemokine ligand 8
• Gene symbol: CCL8
• Synonyms (NCBI Gene): HC14, MCP-2, MCP2, SCYA10, SCYA8
• Chromosome: 17
• Chromosome location: 17q12
• Summary: This antimicrobial gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT050431	hsa-miR-23a-3p	CLASH	23622248
MIRT438289	hsa-miR-92a-3p	Luciferase reporter assay, Western blot, qRT-PCR	25253336
MIRT438289	hsa-miR-92a-3p	Luciferase reporter assay, Western blot, qRT-PCR	25253336
MIRT871120	hsa-miR-1226	CLIP-seq
MIRT871121	hsa-miR-1290	CLIP-seq
MIRT871122	hsa-miR-181a	CLIP-seq
MIRT871123	hsa-miR-181b	CLIP-seq
MIRT871124	hsa-miR-181c	CLIP-seq
MIRT871125	hsa-miR-181d	CLIP-seq
MIRT871126	hsa-miR-33a	CLIP-seq
MIRT871127	hsa-miR-33b	CLIP-seq
MIRT871128	hsa-miR-4262	CLIP-seq
MIRT871129	hsa-miR-450b-5p	CLIP-seq
MIRT871130	hsa-miR-4733-3p	CLIP-seq
MIRT871131	hsa-miR-499-3p	CLIP-seq
MIRT871132	hsa-miR-499a-3p	CLIP-seq
MIRT871133	hsa-miR-507	CLIP-seq
MIRT871134	hsa-miR-557	CLIP-seq
MIRT1958661	hsa-miR-1305	CLIP-seq
MIRT1958662	hsa-miR-203	CLIP-seq
MIRT1958663	hsa-miR-4698	CLIP-seq
MIRT1958664	hsa-miR-607	CLIP-seq
MIRT871120	hsa-miR-1226	CLIP-seq
MIRT2498686	hsa-miR-1324	CLIP-seq
MIRT2498687	hsa-miR-186	CLIP-seq
MIRT2498688	hsa-miR-1910	CLIP-seq
MIRT2498689	hsa-miR-216a	CLIP-seq
MIRT2498690	hsa-miR-216b	CLIP-seq
MIRT2498691	hsa-miR-3065-5p	CLIP-seq
MIRT2498692	hsa-miR-3613-3p	CLIP-seq
MIRT2498693	hsa-miR-3653	CLIP-seq
MIRT2498694	hsa-miR-3658	CLIP-seq
MIRT2498695	hsa-miR-3670	CLIP-seq
MIRT2498696	hsa-miR-3682-3p	CLIP-seq
MIRT2498697	hsa-miR-3689a-3p	CLIP-seq
MIRT2498698	hsa-miR-3689c	CLIP-seq
MIRT2498699	hsa-miR-3691-5p	CLIP-seq
MIRT2498700	hsa-miR-4264	CLIP-seq
MIRT2498701	hsa-miR-4266	CLIP-seq
MIRT2498702	hsa-miR-4419a	CLIP-seq
MIRT2498703	hsa-miR-4424	CLIP-seq
MIRT2498704	hsa-miR-4493	CLIP-seq
MIRT2498705	hsa-miR-4510	CLIP-seq
MIRT2498706	hsa-miR-4522	CLIP-seq
MIRT2498707	hsa-miR-455-3p	CLIP-seq
MIRT2498708	hsa-miR-4695-5p	CLIP-seq
MIRT2498709	hsa-miR-4700-3p	CLIP-seq
MIRT2498710	hsa-miR-4716-5p	CLIP-seq
MIRT2498711	hsa-miR-4728-5p	CLIP-seq
MIRT871130	hsa-miR-4733-3p	CLIP-seq
MIRT2498712	hsa-miR-4751	CLIP-seq
MIRT2498713	hsa-miR-4752	CLIP-seq
MIRT2498714	hsa-miR-4753-3p	CLIP-seq
MIRT2498715	hsa-miR-4764-5p	CLIP-seq
MIRT2498716	hsa-miR-4779	CLIP-seq
MIRT2498717	hsa-miR-4797-3p	CLIP-seq
MIRT871131	hsa-miR-499-3p	CLIP-seq
MIRT871132	hsa-miR-499a-3p	CLIP-seq
MIRT2498718	hsa-miR-5095	CLIP-seq
MIRT2498719	hsa-miR-5096	CLIP-seq
MIRT2498720	hsa-miR-513a-5p	CLIP-seq
MIRT2498721	hsa-miR-520g	CLIP-seq
MIRT2498722	hsa-miR-520h	CLIP-seq
MIRT2498723	hsa-miR-548c-3p	CLIP-seq
MIRT2498724	hsa-miR-570	CLIP-seq
MIRT2498725	hsa-miR-640	CLIP-seq
MIRT2498726	hsa-miR-656	CLIP-seq
MIRT2498727	hsa-miR-944	CLIP-seq
MIRT871120	hsa-miR-1226	CLIP-seq
MIRT871121	hsa-miR-1290	CLIP-seq
MIRT2498686	hsa-miR-1324	CLIP-seq
MIRT2498687	hsa-miR-186	CLIP-seq
MIRT2498688	hsa-miR-1910	CLIP-seq
MIRT2498689	hsa-miR-216a	CLIP-seq
MIRT2498690	hsa-miR-216b	CLIP-seq
MIRT2498691	hsa-miR-3065-5p	CLIP-seq
MIRT2498692	hsa-miR-3613-3p	CLIP-seq
MIRT2498693	hsa-miR-3653	CLIP-seq
MIRT2498694	hsa-miR-3658	CLIP-seq
MIRT2498695	hsa-miR-3670	CLIP-seq
MIRT2498696	hsa-miR-3682-3p	CLIP-seq
MIRT2498697	hsa-miR-3689a-3p	CLIP-seq
MIRT2498698	hsa-miR-3689c	CLIP-seq
MIRT2498699	hsa-miR-3691-5p	CLIP-seq
MIRT2498700	hsa-miR-4264	CLIP-seq
MIRT2498701	hsa-miR-4266	CLIP-seq
MIRT2498702	hsa-miR-4419a	CLIP-seq
MIRT2498703	hsa-miR-4424	CLIP-seq
MIRT2498704	hsa-miR-4493	CLIP-seq
MIRT871129	hsa-miR-450b-5p	CLIP-seq
MIRT2498705	hsa-miR-4510	CLIP-seq
MIRT2498706	hsa-miR-4522	CLIP-seq
MIRT2498707	hsa-miR-455-3p	CLIP-seq
MIRT2498708	hsa-miR-4695-5p	CLIP-seq
MIRT2498709	hsa-miR-4700-3p	CLIP-seq
MIRT2498710	hsa-miR-4716-5p	CLIP-seq
MIRT2498711	hsa-miR-4728-5p	CLIP-seq
MIRT871130	hsa-miR-4733-3p	CLIP-seq
MIRT2498712	hsa-miR-4751	CLIP-seq
MIRT2498713	hsa-miR-4752	CLIP-seq
MIRT2498714	hsa-miR-4753-3p	CLIP-seq
MIRT2498715	hsa-miR-4764-5p	CLIP-seq
MIRT2498716	hsa-miR-4779	CLIP-seq
MIRT2498717	hsa-miR-4797-3p	CLIP-seq
MIRT871131	hsa-miR-499-3p	CLIP-seq
MIRT871132	hsa-miR-499a-3p	CLIP-seq
MIRT871133	hsa-miR-507	CLIP-seq
MIRT2498718	hsa-miR-5095	CLIP-seq
MIRT2498719	hsa-miR-5096	CLIP-seq
MIRT2498720	hsa-miR-513a-5p	CLIP-seq
MIRT2498721	hsa-miR-520g	CLIP-seq
MIRT2498722	hsa-miR-520h	CLIP-seq
MIRT2498723	hsa-miR-548c-3p	CLIP-seq
MIRT871134	hsa-miR-557	CLIP-seq
MIRT2498724	hsa-miR-570	CLIP-seq
MIRT2498725	hsa-miR-640	CLIP-seq
MIRT2498726	hsa-miR-656	CLIP-seq
MIRT2498727	hsa-miR-944	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002687	Process	Positive regulation of leukocyte migration	IEA
GO:0004672	Function	Protein kinase activity	IDA	10734056
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	28381538
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006816	Process	Calcium ion transport	IDA	10734056
GO:0006874	Process	Intracellular calcium ion homeostasis	IDA	10734056
GO:0006887	Process	Exocytosis	IDA	10734056
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	9468473
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	TAS	9119400
GO:0007267	Process	Cell-cell signaling	IDA	10734056
GO:0008009	Function	Chemokine activity	IBA
GO:0008009	Function	Chemokine activity	IEA
GO:0008009	Function	Chemokine activity	TAS	9468473
GO:0008201	Function	Heparin binding	IEA
GO:0009615	Process	Response to virus	TAS	9468473
GO:0016004	Function	Phospholipase activator activity	IDA	10734056
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0031640	Process	Killing of cells of another organism	IDA	12949249
GO:0044828	Process	Host-mediated suppression of viral genome replication	IDA	20181935
GO:0045663	Process	Positive regulation of myoblast differentiation	IEA
GO:0048020	Function	CCR chemokine receptor binding	IBA
GO:0048245	Process	Eosinophil chemotaxis	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12949249
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA
GO:0070664	Process	Negative regulation of leukocyte proliferation	IEA
GO:1901741	Process	Positive regulation of myoblast fusion	IEA

Other IDs

• MIM: 602283
• HGNC: 10635
• e!Ensembl: ENSG00000108700

Protein

• UniProt ID: P80075
• Protein name: C-C motif chemokine 8 (HC14) (Monocyte chemoattractant protein 2) (Monocyte chemotactic protein 2) (MCP-2) (Small-inducible cytokine A8) [Cleaved into: MCP-2(6-76)]
• Protein function: Chemotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils. May play a role in neoplasia and inflammatory host responses. This protein can bind heparin. The processed form MCP-2(6-76) does not show monocyte chemotactic ac
• PDB: 1ESR, 7S59, 7S5A
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00048	IL8	32 → 90	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highest expression found in the small intestine and peripheral blood cells. Intermediate levels seen in the heart, placenta, lung, skeletal muscle, thymus, colon, ovary, spinal cord and pancreas. Low levels seen in the brain, liver, sp
• Sequence:

  MKVSAALLCLLLMAATFSPQGLAQPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCP
  KEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP

• Sequence length: 99

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Anastomotic Leak	Stimulate	32307587	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Inhibit	12871422	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Associate	17321344	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Associate	27411480	★☆☆☆☆ Found in Text Mining only
Ascites	Associate	31039761	★☆☆☆☆ Found in Text Mining only
Asthma	Stimulate	38253462	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	30451357, 30850664, 33146700, 34160019, 35725915	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	33146700, 33682749	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Associate	33146700	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Associate	30841468	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	35043231	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	25774687, 36136589	★☆☆☆☆ Found in Text Mining only
Conjunctivitis Allergic	Associate	11090473	★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	32920092, 33138195, 34987646, 35145507	★☆☆☆☆ Found in Text Mining only
COVID 19	Stimulate	34157151	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Stimulate	28821884	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Associate	32280674	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Associate	26268591	★☆☆☆☆ Found in Text Mining only
Drug Eruptions	Associate	34157151	★☆☆☆☆ Found in Text Mining only
Drug Hypersensitivity	Stimulate	17982926	★☆☆☆☆ Found in Text Mining only
Encephalitis	Inhibit	20181935	★☆☆☆☆ Found in Text Mining only
Encephalitis	Stimulate	24413261	★☆☆☆☆ Found in Text Mining only
Gardner Syndrome	Stimulate	33682749	★☆☆☆☆ Found in Text Mining only
Gastritis	Associate	36973348	★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Associate	20583211	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Associate	15770052	★☆☆☆☆ Found in Text Mining only
Hypoxia	Associate	31263103	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Stimulate	28057004	★☆☆☆☆ Found in Text Mining only
Infections	Associate	28103897	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	11090473, 12134029, 15701693, 24413261, 32307587, 33239683, 35967338, 38203178, 39247198	★☆☆☆☆ Found in Text Mining only
Inflammation	Stimulate	24920275	★☆☆☆☆ Found in Text Mining only
Iron Deficiencies	Inhibit	36136589	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Stimulate	35203308	★☆☆☆☆ Found in Text Mining only
Latent Tuberculosis	Associate	27852671	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Associate	35203308	★☆☆☆☆ Found in Text Mining only
Lymphoma B Cell	Stimulate	19797726	★☆☆☆☆ Found in Text Mining only
Lymphoma Large B Cell Diffuse	Associate	22980495, 36072582	★☆☆☆☆ Found in Text Mining only
Macrophage Activation Syndrome	Associate	38124139	★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	32719391, 33688507, 34032721, 35135212	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Associate	33168410	★☆☆☆☆ Found in Text Mining only
Mental Disorders	Associate	39566744	★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Stimulate	27091721	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Associate	33545567	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	12644822	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Associate	18602166	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Inhibit	35967338	★☆☆☆☆ Found in Text Mining only
Myalgia	Stimulate	27091721	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Associate	20625511	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	33682749, 34160019, 35845981	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	30930117, 31263103, 32191346, 33146700, 33545567, 33682749, 34160019, 34885960, 35043231, 38067195	★☆☆☆☆ Found in Text Mining only
Nephrogenic Fibrosing Dermopathy	Associate	20959327	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Associate	36973348	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	29170526, 37155466	★☆☆☆☆ Found in Text Mining only
Pain	Associate	35845981	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	30841468	★☆☆☆☆ Found in Text Mining only
Personality Disorders	Associate	39566744	★☆☆☆☆ Found in Text Mining only
Proteinuria	Stimulate	35203308	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Associate	24743863	★☆☆☆☆ Found in Text Mining only
Q Fever	Stimulate	28793883	★☆☆☆☆ Found in Text Mining only
Renal Insufficiency Chronic	Stimulate	35203308	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Associate	34987646	★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Associate	31814701	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Associate	17982926	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Associate	28057004	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Associate	33682749	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Associate	24743863	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Stimulate	39185422	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	33545567	★☆☆☆☆ Found in Text Mining only
Still's Disease Adult Onset	Associate	38124139	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	22468089	★☆☆☆☆ Found in Text Mining only
Thyroiditis Suppurative	Associate	36853509	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Associate	35377948	★☆☆☆☆ Found in Text Mining only
Tuberculosis	Associate	35969076	★☆☆☆☆ Found in Text Mining only
Ureteral Obstruction	Stimulate	35203308	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	34893045	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	31263103	★☆☆☆☆ Found in Text Mining only
Virus Diseases	Associate	28103897	★☆☆☆☆ Found in Text Mining only