Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6355
Gene name Gene Name - the full gene name approved by the HGNC.	C-C motif chemokine ligand 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CCL8
Synonyms (NCBI Gene) Gene synonyms aliases	HC14, MCP-2, MCP2, SCYA10, SCYA8
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q12
Summary Summary of gene provided in NCBI Entrez Gene.	This antimicrobial gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies

Show/Hide all(118)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050431	hsa-miR-23a-3p	CLASH	23622248
MIRT438289	hsa-miR-92a-3p	Luciferase reporter assay, Western blot, qRT-PCR	25253336
MIRT438289	hsa-miR-92a-3p	Luciferase reporter assay, Western blot, qRT-PCR	25253336
MIRT871120	hsa-miR-1226	CLIP-seq
MIRT871121	hsa-miR-1290	CLIP-seq
MIRT871122	hsa-miR-181a	CLIP-seq
MIRT871123	hsa-miR-181b	CLIP-seq
MIRT871124	hsa-miR-181c	CLIP-seq
MIRT871125	hsa-miR-181d	CLIP-seq
MIRT871126	hsa-miR-33a	CLIP-seq
MIRT871127	hsa-miR-33b	CLIP-seq
MIRT871128	hsa-miR-4262	CLIP-seq
MIRT871129	hsa-miR-450b-5p	CLIP-seq
MIRT871130	hsa-miR-4733-3p	CLIP-seq
MIRT871131	hsa-miR-499-3p	CLIP-seq
MIRT871132	hsa-miR-499a-3p	CLIP-seq
MIRT871133	hsa-miR-507	CLIP-seq
MIRT871134	hsa-miR-557	CLIP-seq
MIRT1958661	hsa-miR-1305	CLIP-seq
MIRT1958662	hsa-miR-203	CLIP-seq
MIRT1958663	hsa-miR-4698	CLIP-seq
MIRT1958664	hsa-miR-607	CLIP-seq
MIRT871120	hsa-miR-1226	CLIP-seq
MIRT2498686	hsa-miR-1324	CLIP-seq
MIRT2498687	hsa-miR-186	CLIP-seq
MIRT2498688	hsa-miR-1910	CLIP-seq
MIRT2498689	hsa-miR-216a	CLIP-seq
MIRT2498690	hsa-miR-216b	CLIP-seq
MIRT2498691	hsa-miR-3065-5p	CLIP-seq
MIRT2498692	hsa-miR-3613-3p	CLIP-seq
MIRT2498693	hsa-miR-3653	CLIP-seq
MIRT2498694	hsa-miR-3658	CLIP-seq
MIRT2498695	hsa-miR-3670	CLIP-seq
MIRT2498696	hsa-miR-3682-3p	CLIP-seq
MIRT2498697	hsa-miR-3689a-3p	CLIP-seq
MIRT2498698	hsa-miR-3689c	CLIP-seq
MIRT2498699	hsa-miR-3691-5p	CLIP-seq
MIRT2498700	hsa-miR-4264	CLIP-seq
MIRT2498701	hsa-miR-4266	CLIP-seq
MIRT2498702	hsa-miR-4419a	CLIP-seq
MIRT2498703	hsa-miR-4424	CLIP-seq
MIRT2498704	hsa-miR-4493	CLIP-seq
MIRT2498705	hsa-miR-4510	CLIP-seq
MIRT2498706	hsa-miR-4522	CLIP-seq
MIRT2498707	hsa-miR-455-3p	CLIP-seq
MIRT2498708	hsa-miR-4695-5p	CLIP-seq
MIRT2498709	hsa-miR-4700-3p	CLIP-seq
MIRT2498710	hsa-miR-4716-5p	CLIP-seq
MIRT2498711	hsa-miR-4728-5p	CLIP-seq
MIRT871130	hsa-miR-4733-3p	CLIP-seq
MIRT2498712	hsa-miR-4751	CLIP-seq
MIRT2498713	hsa-miR-4752	CLIP-seq
MIRT2498714	hsa-miR-4753-3p	CLIP-seq
MIRT2498715	hsa-miR-4764-5p	CLIP-seq
MIRT2498716	hsa-miR-4779	CLIP-seq
MIRT2498717	hsa-miR-4797-3p	CLIP-seq
MIRT871131	hsa-miR-499-3p	CLIP-seq
MIRT871132	hsa-miR-499a-3p	CLIP-seq
MIRT2498718	hsa-miR-5095	CLIP-seq
MIRT2498719	hsa-miR-5096	CLIP-seq
MIRT2498720	hsa-miR-513a-5p	CLIP-seq
MIRT2498721	hsa-miR-520g	CLIP-seq
MIRT2498722	hsa-miR-520h	CLIP-seq
MIRT2498723	hsa-miR-548c-3p	CLIP-seq
MIRT2498724	hsa-miR-570	CLIP-seq
MIRT2498725	hsa-miR-640	CLIP-seq
MIRT2498726	hsa-miR-656	CLIP-seq
MIRT2498727	hsa-miR-944	CLIP-seq
MIRT871120	hsa-miR-1226	CLIP-seq
MIRT871121	hsa-miR-1290	CLIP-seq
MIRT2498686	hsa-miR-1324	CLIP-seq
MIRT2498687	hsa-miR-186	CLIP-seq
MIRT2498688	hsa-miR-1910	CLIP-seq
MIRT2498689	hsa-miR-216a	CLIP-seq
MIRT2498690	hsa-miR-216b	CLIP-seq
MIRT2498691	hsa-miR-3065-5p	CLIP-seq
MIRT2498692	hsa-miR-3613-3p	CLIP-seq
MIRT2498693	hsa-miR-3653	CLIP-seq
MIRT2498694	hsa-miR-3658	CLIP-seq
MIRT2498695	hsa-miR-3670	CLIP-seq
MIRT2498696	hsa-miR-3682-3p	CLIP-seq
MIRT2498697	hsa-miR-3689a-3p	CLIP-seq
MIRT2498698	hsa-miR-3689c	CLIP-seq
MIRT2498699	hsa-miR-3691-5p	CLIP-seq
MIRT2498700	hsa-miR-4264	CLIP-seq
MIRT2498701	hsa-miR-4266	CLIP-seq
MIRT2498702	hsa-miR-4419a	CLIP-seq
MIRT2498703	hsa-miR-4424	CLIP-seq
MIRT2498704	hsa-miR-4493	CLIP-seq
MIRT871129	hsa-miR-450b-5p	CLIP-seq
MIRT2498705	hsa-miR-4510	CLIP-seq
MIRT2498706	hsa-miR-4522	CLIP-seq
MIRT2498707	hsa-miR-455-3p	CLIP-seq
MIRT2498708	hsa-miR-4695-5p	CLIP-seq
MIRT2498709	hsa-miR-4700-3p	CLIP-seq
MIRT2498710	hsa-miR-4716-5p	CLIP-seq
MIRT2498711	hsa-miR-4728-5p	CLIP-seq
MIRT871130	hsa-miR-4733-3p	CLIP-seq
MIRT2498712	hsa-miR-4751	CLIP-seq
MIRT2498713	hsa-miR-4752	CLIP-seq
MIRT2498714	hsa-miR-4753-3p	CLIP-seq
MIRT2498715	hsa-miR-4764-5p	CLIP-seq
MIRT2498716	hsa-miR-4779	CLIP-seq
MIRT2498717	hsa-miR-4797-3p	CLIP-seq
MIRT871131	hsa-miR-499-3p	CLIP-seq
MIRT871132	hsa-miR-499a-3p	CLIP-seq
MIRT871133	hsa-miR-507	CLIP-seq
MIRT2498718	hsa-miR-5095	CLIP-seq
MIRT2498719	hsa-miR-5096	CLIP-seq
MIRT2498720	hsa-miR-513a-5p	CLIP-seq
MIRT2498721	hsa-miR-520g	CLIP-seq
MIRT2498722	hsa-miR-520h	CLIP-seq
MIRT2498723	hsa-miR-548c-3p	CLIP-seq
MIRT871134	hsa-miR-557	CLIP-seq
MIRT2498724	hsa-miR-570	CLIP-seq
MIRT2498725	hsa-miR-640	CLIP-seq
MIRT2498726	hsa-miR-656	CLIP-seq
MIRT2498727	hsa-miR-944	CLIP-seq

Show/Hide all(30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002548	Process	Monocyte chemotaxis	IBA	21873635
GO:0002687	Process	Positive regulation of leukocyte migration	IEA
GO:0004672	Function	Protein kinase activity	IDA	10734056
GO:0005515	Function	Protein binding	IPI	28381538
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0006468	Process	Protein phosphorylation	IEA
GO:0006816	Process	Calcium ion transport	IDA	10734056
GO:0006874	Process	Cellular calcium ion homeostasis	IDA	10734056
GO:0006887	Process	Exocytosis	IDA	10734056
GO:0006935	Process	Chemotaxis	TAS	9468473
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0007165	Process	Signal transduction	TAS	9119400
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007267	Process	Cell-cell signaling	IDA	10734056
GO:0008009	Function	Chemokine activity	IBA	21873635
GO:0008201	Function	Heparin binding	IEA
GO:0009615	Process	Response to virus	TAS	9468473
GO:0016004	Function	Phospholipase activator activity	IDA	10734056
GO:0030593	Process	Neutrophil chemotaxis	IBA	21873635
GO:0043547	Process	Positive regulation of GTPase activity	IBA	21873635
GO:0044828	Process	Negative regulation by host of viral genome replication	IDA	20181935
GO:0048020	Function	CCR chemokine receptor binding	IBA	21873635
GO:0048245	Process	Eosinophil chemotaxis	IBA	21873635
GO:0048247	Process	Lymphocyte chemotaxis	IBA	21873635
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA	21873635
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA	21873635
GO:0070664	Process	Negative regulation of leukocyte proliferation	IEA
GO:0071346	Process	Cellular response to interferon-gamma	IBA	21873635
GO:0071347	Process	Cellular response to interleukin-1	IBA	21873635
GO:0071356	Process	Cellular response to tumor necrosis factor	IBA	21873635

MIM	HGNC	e!Ensembl
602283	10635	ENSG00000108700

Protein

UniProt ID

P80075

Protein name

C-C motif chemokine 8 (HC14) (Monocyte chemoattractant protein 2) (Monocyte chemotactic protein 2) (MCP-2) (Small-inducible cytokine A8) [Cleaved into: MCP-2(6-76)]

Protein function

Chemotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils. May play a role in neoplasia and inflammatory host responses. This protein can bind heparin. The processed form MCP-2(6-76) does not show monocyte chemotactic ac

PDB

1ESR , 7S59 , 7S5A

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00048	IL8	32 → 90	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

Tissue specificity

TISSUE SPECIFICITY: Highest expression found in the small intestine and peripheral blood cells. Intermediate levels seen in the heart, placenta, lung, skeletal muscle, thymus, colon, ovary, spinal cord and pancreas. Low levels seen in the brain, liver, sp

Sequence

MKVSAALLCLLLMAATFSPQGLAQPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCP
KEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP

Sequence length

Interactions

View interactions

	KEGG
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor Chemokine signaling pathway

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	17568789

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Inflammatory Bowel Disease	Inflammatory Bowel Disease			GWAS

Show/Hide Text Mining Associations (77)

Disease Name	Relationship Type	References
Associations from Text Mining
Anastomotic Leak	Stimulate	32307587
Angina Unstable	Inhibit	12871422
Aortic Aneurysm Abdominal	Associate	17321344
Arthritis Rheumatoid	Associate	27411480
Ascites	Associate	31039761
Asthma	Stimulate	38253462
Breast Neoplasms	Associate	30451357, 30850664, 33146700, 34160019, 35725915
Carcinogenesis	Associate	33146700, 33682749
Carcinoma Basal Cell	Associate	33146700
Carcinoma Pancreatic Ductal	Associate	30841468
Carcinoma Renal Cell	Associate	35043231
Colorectal Neoplasms	Associate	25774687, 36136589
Conjunctivitis Allergic	Associate	11090473
COVID 19	Associate	32920092, 33138195, 34987646, 35145507
COVID 19	Stimulate	34157151
Dermatitis Atopic	Stimulate	28821884
Dermatitis Atopic	Associate	32280674
Diabetes Mellitus	Associate	26268591
Drug Eruptions	Associate	34157151
Drug Hypersensitivity	Stimulate	17982926
Encephalitis	Inhibit	20181935
Encephalitis	Stimulate	24413261
Gardner Syndrome	Stimulate	33682749
Gastritis	Associate	36973348
Hemochromatosis	Associate	20583211
Hepatitis C Chronic	Associate	15770052
Hypoxia	Associate	31263103
Idiopathic Pulmonary Fibrosis	Stimulate	28057004
Infections	Associate	28103897
Inflammation	Associate	11090473, 12134029, 15701693, 24413261, 32307587, 33239683, 35967338, 38203178, 39247198
Inflammation	Stimulate	24920275
Iron Deficiencies	Inhibit	36136589
Kidney Diseases	Stimulate	35203308
Latent Tuberculosis	Associate	27852671
Lung Diseases Interstitial	Associate	35203308
Lymphoma B Cell	Stimulate	19797726
Lymphoma Large B Cell Diffuse	Associate	22980495, 36072582
Macrophage Activation Syndrome	Associate	38124139
Melanoma	Associate	32719391, 33688507, 34032721, 35135212
Melanoma Cutaneous Malignant	Associate	33168410
Mental Disorders	Associate	39566744
Migraine Disorders	Stimulate	27091721
Mouth Neoplasms	Associate	33545567
Multiple Myeloma	Associate	12644822
Multiple Sclerosis	Associate	18602166
Multiple Sclerosis	Inhibit	35967338
Myalgia	Stimulate	27091721
Nasal Polyps	Associate	20625511
Neoplasm Metastasis	Associate	33682749, 34160019, 35845981
Neoplasms	Associate	30930117, 31263103, 32191346, 33146700, 33545567, 33682749, 34160019, 34885960, 35043231, 38067195
Nephrogenic Fibrosing Dermopathy	Associate	20959327
Osteoporosis	Associate	36973348
Ovarian Neoplasms	Associate	29170526, 37155466
Pain	Associate	35845981
Pancreatic Neoplasms	Associate	30841468
Personality Disorders	Associate	39566744
Proteinuria	Stimulate	35203308
Psychotic Disorders	Associate	24743863
Q Fever	Stimulate	28793883
Renal Insufficiency Chronic	Stimulate	35203308
Respiratory Tract Infections	Associate	34987646
Retinal Vein Occlusion	Associate	31814701
Rhinitis Allergic	Associate	17982926
Sarcoidosis	Associate	28057004
Sarcoma Ewing	Associate	33682749
Schizophrenia	Associate	24743863
Spondylitis Ankylosing	Stimulate	39185422
Squamous Cell Carcinoma of Head and Neck	Associate	33545567
Still's Disease Adult Onset	Associate	38124139
Stomach Neoplasms	Associate	22468089
Thyroiditis Suppurative	Associate	36853509
Triple Negative Breast Neoplasms	Associate	35377948
Tuberculosis	Associate	35969076
Ureteral Obstruction	Stimulate	35203308
Urinary Bladder Neoplasms	Associate	34893045
Uterine Cervical Neoplasms	Associate	31263103
Virus Diseases	Associate	28103897

CCL8 (C-C motif chemokine ligand 8)