Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6354
Gene name Gene Name - the full gene name approved by the HGNC.	C-C motif chemokine ligand 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CCL7
Synonyms (NCBI Gene) Gene synonyms aliases	FIC, MARC, MCP-3, MCP3, NC28, SCYA6, SCYA7
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q12
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes monocyte chemotactic protein 3, a secreted chemokine which attracts macrophages during inflammation and metastasis. It is a member of the C-C subfamily of chemokines which are characterized by having two adjacent cysteine residues. The p

Show/Hide all(119)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029409	hsa-miR-26b-5p	Microarray	19088304
MIRT054392	hsa-let-7f-5p	Luciferase reporter assay	22894925
MIRT1958657	hsa-miR-300	CLIP-seq
MIRT1958658	hsa-miR-381	CLIP-seq
MIRT1958659	hsa-miR-4666-3p	CLIP-seq
MIRT1958660	hsa-miR-4789-5p	CLIP-seq
MIRT2436134	hsa-miR-188-3p	CLIP-seq
MIRT2436135	hsa-miR-324-5p	CLIP-seq
MIRT2436136	hsa-miR-4328	CLIP-seq
MIRT2436137	hsa-miR-765	CLIP-seq
MIRT2436134	hsa-miR-188-3p	CLIP-seq
MIRT2436135	hsa-miR-324-5p	CLIP-seq
MIRT2436136	hsa-miR-4328	CLIP-seq
MIRT2436137	hsa-miR-765	CLIP-seq
MIRT2446479	hsa-let-7a	CLIP-seq
MIRT2446480	hsa-let-7b	CLIP-seq
MIRT2446481	hsa-let-7c	CLIP-seq
MIRT2446482	hsa-let-7d	CLIP-seq
MIRT2446483	hsa-let-7e	CLIP-seq
MIRT2446484	hsa-let-7f	CLIP-seq
MIRT2446485	hsa-let-7g	CLIP-seq
MIRT2446486	hsa-let-7i	CLIP-seq
MIRT2446487	hsa-miR-1321	CLIP-seq
MIRT2446488	hsa-miR-202	CLIP-seq
MIRT2446489	hsa-miR-3123	CLIP-seq
MIRT2446490	hsa-miR-3154	CLIP-seq
MIRT2446491	hsa-miR-3925-5p	CLIP-seq
MIRT2446492	hsa-miR-3927	CLIP-seq
MIRT2446493	hsa-miR-4451	CLIP-seq
MIRT2446494	hsa-miR-4458	CLIP-seq
MIRT2446495	hsa-miR-4500	CLIP-seq
MIRT2446496	hsa-miR-4739	CLIP-seq
MIRT2446497	hsa-miR-4756-5p	CLIP-seq
MIRT2436137	hsa-miR-765	CLIP-seq
MIRT2446498	hsa-miR-98	CLIP-seq
MIRT2446479	hsa-let-7a	CLIP-seq
MIRT2446480	hsa-let-7b	CLIP-seq
MIRT2446481	hsa-let-7c	CLIP-seq
MIRT2446482	hsa-let-7d	CLIP-seq
MIRT2446483	hsa-let-7e	CLIP-seq
MIRT2446484	hsa-let-7f	CLIP-seq
MIRT2446485	hsa-let-7g	CLIP-seq
MIRT2446486	hsa-let-7i	CLIP-seq
MIRT2498670	hsa-miR-1273f	CLIP-seq
MIRT2446487	hsa-miR-1321	CLIP-seq
MIRT2498671	hsa-miR-1323	CLIP-seq
MIRT2498672	hsa-miR-143	CLIP-seq
MIRT2436134	hsa-miR-188-3p	CLIP-seq
MIRT2446488	hsa-miR-202	CLIP-seq
MIRT1958657	hsa-miR-300	CLIP-seq
MIRT2498673	hsa-miR-3120-3p	CLIP-seq
MIRT2446489	hsa-miR-3123	CLIP-seq
MIRT2446490	hsa-miR-3154	CLIP-seq
MIRT2436135	hsa-miR-324-5p	CLIP-seq
MIRT2498674	hsa-miR-338-5p	CLIP-seq
MIRT1958658	hsa-miR-381	CLIP-seq
MIRT2446491	hsa-miR-3925-5p	CLIP-seq
MIRT2446492	hsa-miR-3927	CLIP-seq
MIRT2436136	hsa-miR-4328	CLIP-seq
MIRT2446493	hsa-miR-4451	CLIP-seq
MIRT2446494	hsa-miR-4458	CLIP-seq
MIRT2446495	hsa-miR-4500	CLIP-seq
MIRT2498675	hsa-miR-4640-3p	CLIP-seq
MIRT1958659	hsa-miR-4666-3p	CLIP-seq
MIRT2498676	hsa-miR-4668-3p	CLIP-seq
MIRT2498677	hsa-miR-4699-5p	CLIP-seq
MIRT2498678	hsa-miR-4708-5p	CLIP-seq
MIRT2446496	hsa-miR-4739	CLIP-seq
MIRT2446497	hsa-miR-4756-5p	CLIP-seq
MIRT2498679	hsa-miR-4770	CLIP-seq
MIRT1958660	hsa-miR-4789-5p	CLIP-seq
MIRT2498680	hsa-miR-548aa	CLIP-seq
MIRT2498681	hsa-miR-548ac	CLIP-seq
MIRT2498682	hsa-miR-548d-3p	CLIP-seq
MIRT2498683	hsa-miR-548o	CLIP-seq
MIRT2498684	hsa-miR-548z	CLIP-seq
MIRT2498685	hsa-miR-7	CLIP-seq
MIRT2436137	hsa-miR-765	CLIP-seq
MIRT2446498	hsa-miR-98	CLIP-seq
MIRT2446479	hsa-let-7a	CLIP-seq
MIRT2446480	hsa-let-7b	CLIP-seq
MIRT2446481	hsa-let-7c	CLIP-seq
MIRT2446482	hsa-let-7d	CLIP-seq
MIRT2446483	hsa-let-7e	CLIP-seq
MIRT2446484	hsa-let-7f	CLIP-seq
MIRT2446485	hsa-let-7g	CLIP-seq
MIRT2446486	hsa-let-7i	CLIP-seq
MIRT2498670	hsa-miR-1273f	CLIP-seq
MIRT2446487	hsa-miR-1321	CLIP-seq
MIRT2498671	hsa-miR-1323	CLIP-seq
MIRT2498672	hsa-miR-143	CLIP-seq
MIRT2436134	hsa-miR-188-3p	CLIP-seq
MIRT2446488	hsa-miR-202	CLIP-seq
MIRT1958657	hsa-miR-300	CLIP-seq
MIRT2498673	hsa-miR-3120-3p	CLIP-seq
MIRT2446489	hsa-miR-3123	CLIP-seq
MIRT2446490	hsa-miR-3154	CLIP-seq
MIRT2436135	hsa-miR-324-5p	CLIP-seq
MIRT2498674	hsa-miR-338-5p	CLIP-seq
MIRT1958658	hsa-miR-381	CLIP-seq
MIRT2446491	hsa-miR-3925-5p	CLIP-seq
MIRT2446492	hsa-miR-3927	CLIP-seq
MIRT2436136	hsa-miR-4328	CLIP-seq
MIRT2446493	hsa-miR-4451	CLIP-seq
MIRT2446494	hsa-miR-4458	CLIP-seq
MIRT2446495	hsa-miR-4500	CLIP-seq
MIRT2498675	hsa-miR-4640-3p	CLIP-seq
MIRT1958659	hsa-miR-4666-3p	CLIP-seq
MIRT2498676	hsa-miR-4668-3p	CLIP-seq
MIRT2498677	hsa-miR-4699-5p	CLIP-seq
MIRT2498678	hsa-miR-4708-5p	CLIP-seq
MIRT2446496	hsa-miR-4739	CLIP-seq
MIRT2446497	hsa-miR-4756-5p	CLIP-seq
MIRT2498679	hsa-miR-4770	CLIP-seq
MIRT1958660	hsa-miR-4789-5p	CLIP-seq
MIRT2498683	hsa-miR-548o	CLIP-seq
MIRT2498685	hsa-miR-7	CLIP-seq
MIRT2436137	hsa-miR-765	CLIP-seq
MIRT2446498	hsa-miR-98	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
LEF1	Unknown	11118053

Show/Hide all(32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002548	Process	Monocyte chemotaxis	IBA	21873635
GO:0002548	Process	Monocyte chemotaxis	IC	10660125
GO:0005515	Function	Protein binding	IPI	25416956, 26095031, 32296183
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0006874	Process	Cellular calcium ion homeostasis	TAS	10770925
GO:0006935	Process	Chemotaxis	TAS	9780207
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0007010	Process	Cytoskeleton organization	IDA	10072545
GO:0007165	Process	Signal transduction	TAS	10201901, 10770925
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007267	Process	Cell-cell signaling	TAS	7916328
GO:0008009	Function	Chemokine activity	IBA	21873635
GO:0008009	Function	Chemokine activity	IDA	10072545
GO:0008201	Function	Heparin binding	IEA
GO:0008360	Process	Regulation of cell shape	IDA	10072545
GO:0010332	Process	Response to gamma radiation	IEA
GO:0030335	Process	Positive regulation of cell migration	IDA	7545673
GO:0030593	Process	Neutrophil chemotaxis	IBA	21873635
GO:0031726	Function	CCR1 chemokine receptor binding	IPI	7545673, 10660125
GO:0031727	Function	CCR2 chemokine receptor binding	IEA
GO:0043547	Process	Positive regulation of GTPase activity	IBA	21873635
GO:0048020	Function	CCR chemokine receptor binding	IBA	21873635
GO:0048245	Process	Eosinophil chemotaxis	IBA	21873635
GO:0048245	Process	Eosinophil chemotaxis	IDA	10072545
GO:0048247	Process	Lymphocyte chemotaxis	IBA	21873635
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA	21873635
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA	21873635
GO:0071346	Process	Cellular response to interferon-gamma	IBA	21873635
GO:0071347	Process	Cellular response to interleukin-1	IBA	21873635
GO:0071356	Process	Cellular response to tumor necrosis factor	IBA	21873635
GO:0071361	Process	Cellular response to ethanol	IEA
GO:2000503	Process	Positive regulation of natural killer cell chemotaxis	IDA	7545673

MIM	HGNC	e!Ensembl
158106	10634	ENSG00000108688

Protein

UniProt ID

P80098

Protein name

C-C motif chemokine 7 (Monocyte chemoattractant protein 3) (Monocyte chemotactic protein 3) (MCP-3) (NC28) (Small-inducible cytokine A7)

Protein function

Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity. Also induces the release of gelatinase B. This protein can bind heparin. Binds to CCR1, CCR2 and CCR3.

PDB

1BO0 , 1NCV , 4ZKC , 7S58 , 7S59 , 7SCU , 8FJ3 , 8FK6 , 8FK8 , 8JPS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00048	IL8	32 → 90	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

Sequence

MKASAALLCLLLTAAAFSPQGLAQPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSHCP
REAVIFKTKLDKEICADPTQKWVQDFMKHLDKKTQTPKL

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor Chemokine signaling pathway IL-17 signaling pathway		Chemokine receptors bind chemokines

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Cholestasis	Cholestasis	rs121909103, rs751511532, rs376368459, rs762702807, rs1578490102, rs1578499691, rs1578504946, rs1317656688, rs199791850, rs1452792080, rs1578491039	21224055
Glomerulonephritis	Glomerulonephritis	rs778043831	10385480

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Source
Unknown
Crohn Disease	Crohn Disease	GWAS
Inflammatory Bowel Disease	Inflammatory Bowel Disease	GWAS
Ulcerative colitis	Ulcerative colitis	GWAS

Show/Hide Text Mining Associations (62)

Disease Name	Relationship Type	References
Associations from Text Mining
Ascites	Associate	31039761
Asthma	Associate	12854631
Atelosteogenesis type 2	Inhibit	34425224
Atherosclerosis	Associate	28821884
Atrial Fibrillation	Associate	37304261
Bone Resorption	Associate	35715847
Breast Neoplasms	Associate	26896000, 30850664
Carcinogenesis	Associate	33682749
Carcinoma Renal Cell	Associate	24327013, 37902279
Cardiovascular Diseases	Associate	37304261
Colitis Collagenous	Stimulate	25948880
Colitis Lymphocytic	Stimulate	25948880
Colitis Ulcerative	Stimulate	10433925
Colorectal Neoplasms	Associate	22363134, 33175885, 35283273, 35715847, 36693067
COVID 19	Associate	32360286, 32920092, 34157151, 34177897, 34335580, 34450402, 34960725, 35145507, 35303909, 36012423
Critical Illness	Stimulate	32360286
Death	Associate	34960725
Dermatitis Atopic 1	Stimulate	8980953
Dermatitis Atopic 3	Stimulate	8980953
Drug Eruptions	Associate	34157151
Drug Hypersensitivity	Associate	17982926, 7539041
Endophthalmitis	Stimulate	30296277
Fatigue	Associate	37881427
Gardner Syndrome	Associate	33682749
Giant Cell Arteritis	Associate	39817309
Glaucoma Angle Closure	Associate	26748993
Idiopathic Pulmonary Fibrosis	Associate	34948231
Infections	Inhibit	10497106
Infections	Stimulate	25600596
Inflammation	Associate	10205198, 12134029, 26990868, 30475413, 33239683, 35303909, 35686910, 36779490, 37554265
Inflammatory Bowel Diseases	Associate	10205198
Leukemia	Associate	37554265
Lung Injury	Associate	35686910
Lymphatic Metastasis	Stimulate	22468089
Mesothelioma Malignant	Associate	25162674
Multiple Myeloma	Associate	12644822
Neoplasm Metastasis	Associate	22468089, 24327013, 33682749, 36347994
Neoplasms	Associate	22468089, 24327013, 33682749, 36347994, 39249543
Neoplasms Adipose Tissue	Associate	31718015
Neuralgia	Associate	29672183
Neurologic Manifestations	Stimulate	34450402
Obstetric Labor Premature	Associate	24876667
Osteolysis	Associate	35715847
Osteoporosis	Associate	36755691, 38567587
Ovarian Neoplasms	Associate	37155466
Pleural Effusion	Stimulate	35819097
Pre Eclampsia	Stimulate	27780270
Psychotic Disorders	Associate	25970596
Pulmonary Disease Chronic Obstructive	Stimulate	21327296
Pulmonary Disease Chronic Obstructive	Associate	21883889, 34335580
Reperfusion Injury	Associate	32696819
Respiratory Distress Syndrome	Stimulate	27496101
Retinal Vein Occlusion	Associate	31814701
Rhinitis Allergic	Associate	17982926
Sarcoma Ewing	Associate	33682749
Scleroderma Systemic	Stimulate	16014681
Shock Cardiogenic	Associate	35729851
Stomach Neoplasms	Associate	22468089
Takayasu Arteritis	Associate	39817309
Triple Negative Breast Neoplasms	Associate	36347994
Tuberculosis Multidrug Resistant	Stimulate	33977111
Ventricular Remodeling	Inhibit	32701210

CCL7 (C-C motif chemokine ligand 7)