Gene Gene information from NCBI Gene database.
Entrez ID 6354
Gene name C-C motif chemokine ligand 7
Gene symbol CCL7
Synonyms (NCBI Gene)
FICMARCMCP-3MCP3NC28SCYA6SCYA7
Chromosome 17
Chromosome location 17q12
Summary This gene encodes monocyte chemotactic protein 3, a secreted chemokine which attracts macrophages during inflammation and metastasis. It is a member of the C-C subfamily of chemokines which are characterized by having two adjacent cysteine residues. The p
miRNA miRNA information provided by mirtarbase database.
119
miRTarBase ID miRNA Experiments Reference
MIRT029409 hsa-miR-26b-5p Microarray 19088304
MIRT054392 hsa-let-7f-5p Luciferase reporter assay 22894925
MIRT1958657 hsa-miR-300 CLIP-seq
MIRT1958658 hsa-miR-381 CLIP-seq
MIRT1958659 hsa-miR-4666-3p CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
LEF1 Unknown 11118053
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
41
GO ID Ontology Definition Evidence Reference
GO:0002548 Process Monocyte chemotaxis IC 10660125
GO:0005125 Function Cytokine activity IEA
GO:0005515 Function Protein binding IPI 25416956, 26095031, 27044744, 32296183
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
158106 10634 ENSG00000108688
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P80098
Protein name C-C motif chemokine 7 (Monocyte chemoattractant protein 3) (Monocyte chemotactic protein 3) (MCP-3) (NC28) (Small-inducible cytokine A7)
Protein function Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity. Also induces the release of gelatinase B. This protein can bind heparin. Binds to CCR1, CCR2 and CCR3.
PDB 1BO0 , 1NCV , 4ZKC , 7S58 , 7S59 , 7SCU , 8FJ3 , 8FK6 , 8FK8 , 8JPS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8 32 90 Small cytokines (intecrine/chemokine), interleukin-8 like Domain
Sequence
MKASAALLCLLLTAAAFSPQGLAQPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSHCP
REAVIFKTKLDKEICADPTQKWVQDFMKHL
DKKTQTPKL
Sequence length 99
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
IL-17 signaling pathway
  Chemokine receptors bind chemokines